KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107284835Help
Entry
107284835         CDS       T05763                                 

Gene name
ATM
Definition
(RefSeq) LOW QUALITY PROTEIN: serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03440  Homologous recombination
pmur04068  FoxO signaling pathway
pmur04110  Cell cycle
pmur04115  p53 signaling pathway
pmur04210  Apoptosis
pmur04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    107284835 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107284835 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107284835 (ATM)
   04210 Apoptosis
    107284835 (ATM)
   04115 p53 signaling pathway
    107284835 (ATM)
   04218 Cellular senescence
    107284835 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmur01001]
    107284835 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pmur03032]
    107284835 (ATM)
   03400 DNA repair and recombination proteins [BR:pmur03400]
    107284835 (ATM)
Enzymes [BR:pmur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107284835 (ATM)
Protein kinases [BR:pmur01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   107284835 (ATM)
DNA replication proteins [BR:pmur03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     107284835 (ATM)
DNA repair and recombination proteins [BR:pmur03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    107284835 (ATM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC HEAT DUF1031
Motif
Other DBs
NCBI-GeneID: 107284835
NCBI-ProteinID: XP_029139372
LinkDB All DBs
Position
Unknown
AA seq 3040 aa AA seqDB search
MNLAIHNLLACCHQLGSDKAMERKKEIEKFKRLICDPETVQQLDRNSDSKHGKQMNWDAV
FRFLQKYIQKEVESVRAAKSNASASSQATRQKKMKQFSSLVKDFIMCANKRAPRIKCQEL
LNYVIDTINESSRYAIYGADCNSILLKDILKVRKYWCEISPQQWSDLQNLYFNLFLNPSG
DVNKVLVARIIYTLTRGLCFQTDKFNSDILNFFSKVVHRARQERNLAGLDHIFAAINVFF
PIYGMNYRMQVCKTGEEILSTVLFIWAQYKPKDALKEQIIQFVQFQICIHHPNGAKTQEE
GAYSSAKWQNTLYNLYDLLANEITLTSSRGKYSSGSRRIVLKDNLVELMADSCHQVFTED
IKVLEVTQSYAVIPQEAEDGEGPSKRRKIELGWEVIQEHLQKSQNSFDVIPWLQITTRLI
SKYPRSLPDNELTNLLNILYQLLLQQRRGERTPYVLRCLKEVALCQSQKIDLSITQKFEL
QRTWSRIWSLVDRSLNLRQTEMESFELLGVLFQSNLITTDREIWRIFAGSICKPSSFAVQ
CLASAMTALEIPETLKTGSFQNDWEGNATYTLKERVVKWLLFCSVEEVMEDSMELPPVLC
SDFPKLELQKILVSLTMKNCRAAMAFFNSAPKCMEHTQEKEETSLSEIEAFYLQTTFNEI
NSFTNMADVSEHKSSSSCLIVNQRLEETLKHDLLMMLEQLLSNVSLETIPVEILMRFTSL
LTGVLGCYCYAGILTEEEARKLDFFQKAKLCFNYVEESISQSKNKLTEDSRIVSLRNLIL
QCTSCLCNCSQNSPKKSLSTIFLHLLTSKLMNDLANICKLLMFSTGKSSEAGEVDLMEDF
PEESRMEEGNQTVFDLFDDESNEVGEVNEVGDLHTLKGAKSPLSEDHLSKQDLLLLDVLK
FLCIATTATTVQTVPFRCSEIWRKLLVLIDGNSFDFIKPLHLHVYLVLLKELPSGENPLP
EEYVVSLLKLLPEICSFYRWDQDVCAAILHNLLPMVTILGTFNRNSEDLREARCQILAVV
GAFWHLANEGKCSVLVRISLVNCMTAFLHADPYSEWAVLTFKSENLPVRDAFPQFLADNN
FQVCTIAAKSAISLFQDVKLRDTTGLVKGLPLKFQQRAFENLYIKVQEGAKNLVIQKSHP
DEEHNRKTVLLMLITMILYSSPVCEKQALFAIFQCIKRNGLDPQLVRKVLENISGSFGYK
NTEDLMSTHLDYLIFEWLNCDYSLSDFPYILLNCSTLEEFYRSCYKVLIPQLIIRDQFEE
IKSIASHINTEERHLLAQCFPKILVNILPYFAYQNHEHIEFTQKSNTASRVYDMLKDENC
LGKQLIDSLFHSSLPEIVVEVLMILHEPANIKPEENSDLIKFTGNLDPAPNPPYFPSYII
QATLDYINRCYKTKFNDIIAILSKNPESFHKILFAVWKQVSGTRNNYKKHRMLMIYHFFV
NLLLKEIKTGLGGAWAFVLRDVIYSMIRHISNRPNPLRGVSLRSFLLCCDLLNRVCHTAV
QYCQDALASHLHVVVGTLIPIVGEQPETEEEVLSLLKYLVIDNQNNEYLYQAIKLLDPFP
DHPHFKELRATQQKIKYSTGKFSLLEEINHFLSINISDSLFLTRLEGLNDLHKQLEDHKE
QIMEFMKKFQENPKDCIIVKLMAYLLQLSKTTVHSTDTILEAVASCLGEIGPINFSTIAL
QHSKNGSNSNTCDLFEDRELQWVFVILTLINNYLIDQCIEVRSAAAASLKNILATKTGHT
FCEKYKTKTDTMLIYLNPFRTSKKKLLEVPGKVRETPPEDLDRAILWIPHSESHEIWIKT
LTCALLDSGMITSEILLLLKPLCQVHADFCQTVLPYLIHDILLHDSNESGHSLLSAQIQS
FFMTCCKYSSPSRSSTPANLDSESETPAHGHLDKISRRTMLAVVDYLRRQKKNPSSTIFD
DSFWLELSYLQVAMVAQSCSAHFTALLYAEIYADKIGRQQERXSTKKLTFEEGSQNSTFT
CLSEKSKEETGISLQDLLMDIYRSIGEPDSLYGCGGGKMLQPLPRIRTYEHEGTWGKALV
TYDLETSLPPSIRQTGLVEALQNYGLCNTLSIYLKGLEQQNEESSIELQEIRYQAAWRNM
QWDQISSVKDEIEQRGYHESLYDALQCLRDRDFSTFYGRLKCARIKEVEELLKGSLESVY
SLLPTLCRLQTIGELEYVGQLFSGYFTISLYIILALQNYGLCNTLSIYLKGLEQQNEESS
IELQEIRYQAAWRNMQWDQISSVKDEIEQRGYHESLYDALQCLRDRDFSTFYGRLKCARI
KEVEELLKGSLESVYSLLPTLCRLQTIGELEYVGQLFSGSETNSQLHNLHLKWQKQSQLL
QDSDFAFQEPIMALRTVILKILLEKENENVQRECIKNILTEHLVELSRLARMANNSQKLS
LSAGKLTAWVQELTEEHKVQTSRYTVKVQRELEIDECEIRALGEDRKRFLCKAVENYIMC
LLSGEEHDMWIFRLCSLWLENAGLSEVNDMIQKEAQKIPSYKFLPLMYQLAARMGTRMSG
FHEILNNLIARISLDHPHHTLFIILALANANKDEFLAKPEVTKRSGLIKNVPKETSLLDK
DRMKAASSIINIVKRKKPDMVAKVEALCDAYIILANMDATPWKTHRRGINIPSDQPITKL
KNLEDVAVPTMEIKVDPSGKYEHLITITSFKPEFRLAGGVNLPKIIDCVGSDGQQRRQLV
KGRDDLRQDAVMQQVFQMCNTLLQQDADTRKRKLTIRRYKVVPLSQRSGVLEWCTGTIPL
GEFLINTDSSAHKRYRPQDYSSIDCQRKMIDAQKKDFEEKYTVFMDVCQNFQPVFRYFCM
ERFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILLDEESAELVHIDLGVAFEQ
GKILPTPETVPFRLTRDVVDGMGIAGVEGVFRRCCEKTMNVMRNSQEALLTIVEVLLYDP
LFDWTMNPLKALYLQQRSEDEADVSSNFSSADQGCNKKSNNESQLFNKVAERVLIRLQEK
LKGMEEGTVLSVAGQVNFLIQQAMDPKNLSRLFPGWKPWV
NT seq 9123 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttgcaattcataatctgttggcttgctgtcatcagcttggaagtgacaaagct
atggaaagaaagaaggaaattgagaagttcaagcgtcttatctgtgatccagaaacagtt
cagcagctggatcggaattctgattccaaacacggaaaacagatgaactgggatgctgta
ttcaggtttttgcagaaatatattcagaaagaggttgagagtgtcagagcagcaaaatca
aatgcctctgcatcaagccaagcaacacgtcagaaaaagatgaaacagttcagtagtttg
gttaaggatttcatcatgtgtgccaataaaagagcccccagaataaaatgtcaggagctt
ctgaattatgtaatagacacaatcaatgagtcatcaagatatgctatttatggggccgat
tgtaatagcatattacttaaggacattctgaaagtgaggaaatattggtgtgaaatatca
ccacaacagtggtcagatctccaaaatctgtacttcaacttatttctcaatccttctgga
gatgttaacaaagttttggtggctagaataatctatacattaactagaggcctctgtttc
caaactgacaagttcaattcagatattttgaacttcttctcaaaagttgtacatcgtgca
aggcaagaaagaaaccttgcaggcctcgaccacatttttgcagccattaatgtgtttttc
cccatttatggaatgaattaccgcatgcaagtttgcaaaacaggagaggaaattctatca
actgtgctttttatatgggctcagtacaaaccaaaagatgccttgaaggaacagatcatt
cagtttgttcagtttcagatttgtattcatcatccaaatggagctaaaactcaggaagaa
ggagcatacagctcagcaaaatggcagaatactttatacaacctctatgatctgttagct
aatgagataacgcttactagcagccgaggaaaatattcttcaggctcacgccgtattgtt
ctaaaggacaacctggttgagttaatggctgattcttgtcatcaggtgtttactgaagac
atcaaagtcttggaagtaacccagtcatatgcagttattccacaagaagctgaagatgga
gaaggaccatccaaacgtagaaaaattgaattaggatgggaagtgattcaagaacatttg
caaaaatcacagaatagttttgatgtcataccctggctgcagattaccaccagattaata
tccaagtacccaaggagtcttcctgacaatgagttgactaatttacttaatatactttac
caattattacttcagcaacgtcgaggagaacggaccccttatgtattaagatgtcttaaa
gaggttgctctgtgtcaaagccaaaaaatagatctcagtatcacacagaagtttgaactg
caacgaacatggtccagaatttggtctctggtagatcgaagtttaaaccttcgacaaact
gaaatggaaagctttgaattgcttggagtcctatttcaaagcaatttaataacaacggac
agggaaatttggaggatatttgcaggttctatatgcaaaccatcaagttttgctgtacag
tgtttagcatcagcgatgacagctttggaaataccagaaactttgaaaactggatcattt
cagaatgattgggaaggaaatgcaacttatacactaaaagaacgagttgtgaaatggctt
ctcttctgctctgtggaggaagttatggaagatagcatggaactccctccagttttgtgc
agtgactttcctaagctagaattacagaagatccttgtaagtctgactatgaaaaattgt
agagcggcaatggcatttttcaacagtgcaccaaaatgcatggaacatacccaagagaaa
gaagaaaccagtctttcagaaattgaagctttttacctgcagacaaccttcaatgaaatc
aatagttttacaaatatggcagatgtatcagaacacaaatcttctagttcctgcctcatt
gtcaatcagaggcttgaagaaaccttaaaacacgatcttctgatgatgttggagcagcta
cttagcaacgtttctcttgagactatacctgtggaaattctgatgcggtttaccagcctc
ttgactggtgttcttggctgctattgttatgctggcattcttacagaagaagaagcacgt
aaactggatttttttcaaaaagctaagttatgttttaattatgtggaggaaagcatttct
caatctaaaaacaagctaactgaagattctagaattgtttcattgaggaatttaatattg
cagtgcacaagttgtttatgcaactgtagccagaatagtcctaaaaagagtttgtctacc
atcttcttgcatttgttaacatccaagttgatgaatgatcttgcaaatatctgcaaactt
ctgatgttttctactggaaagtcaagtgaagctggagaagtggacttaatggaagatttt
cctgaagaaagtagaatggaagagggaaaccaaacagtctttgatctatttgatgatgag
agtaatgaagttggtgaggtgaatgaagttggagacttacacaccttgaaaggtgccaaa
agtccattatcagaagaccatctgtctaagcaggatttgcttcttcttgatgttttgaag
ttcttgtgtatagctaccacagcaaccacagtacaaacagttccctttagatgttccgaa
atttggaggaaacttttagtgctaattgatggaaattcatttgattttatcaaaccttta
catttacatgtgtatttagtcttgttgaaggaacttcccagtggagaaaaccccttgcca
gaagaatatgttgtctctttactcaagcttctaccggagatatgttccttttatcgttgg
gatcaagatgtttgtgcagcaatattacataaccttcttccaatggttactattttggga
accttcaatagaaattccgaagatctaagagaagcccggtgtcaaatcttagctgttgtt
ggagcattttggcatttagcaaatgaagggaaatgttcagttcttgtaagaatttcttta
gtgaattgtatgacagccttccttcatgctgacccttattcagaatgggctgtgcttaca
tttaaaagtgaaaatttacctgtgagagatgcttttcctcaatttcttgcagataacaac
tttcaagtttgtacgattgcagctaagtcagcaatcagtttgttccaagatgtgaaactg
agggatactactggtttagtgaaaggtcttcctttgaaattccaacaacgagcttttgag
aatttgtacatcaaagttcaagaaggagcaaaaaatttggtaatacaaaaaagccatcct
gatgaagaacataacagaaaaacagtcctactcatgttaataactatgattttgtacagc
agtcctgtgtgtgagaaacaagcattgtttgctattttccagtgtattaaaaggaatgga
ttagatcctcagcttgtaaggaaggttttagaaaatatttctggctcttttggttataaa
aatacagaagatttaatgagcacccatttagattatcttatatttgagtggctgaactgt
gattacagcctgtccgattttccatatattttgctaaactgctctactttggaagagttt
tacagatcctgttataaagtcttgattccacaactaataattagagatcagtttgaagaa
ataaaatcaattgccagccacattaatacagaagagcgccaccttctggcacagtgcttc
cccaaaatccttgtcaacattcttccttattttgcctaccaaaaccatgaacatattgaa
ttcacacaaaagagcaatacagcttctagagtctatgacatgttgaaagatgaaaattgc
ttaggaaagcagctgatagatagtttatttcatagcagcttaccagaaattgtggtagag
gtgttgatgatcctacatgagccagccaatatcaaaccagaagagaattctgacttaatt
aagtttacaggaaatctggatcctgctccaaatcctccttattttccatcatatattatc
caagctacactggattacattaatagatgttataaaactaagttcaatgatattatagca
atcctttctaagaaccctgagtcattccacaaaattttatttgctgtatggaagcaggta
tctggaacaagaaacaattataaaaaacatagaatgcttatgatatatcatttttttgta
aatctgctattgaaagaaataaagactggcttaggtggtgcttgggcttttgtattgcgg
gatgtgatttattctatgattcgccacatcagcaacagaccaaatcctttgagaggagta
tccctccggagcttcttgctctgttgtgaccttctcaatcgtgtttgtcacacagcagta
cagtattgtcaggatgctctagcgagtcacctccatgttgtcgtgggtacactaatacca
atagttggagaacaacctgaaactgaagaagaggtcttgagcttattgaagtatctagtg
atagataatcagaacaatgaatatttataccaagcaatcaaattattagatccatttcct
gatcatcctcattttaaagaactacgggccactcaacaaaagattaaatacagcactgga
aaattttctcttttggaggaaattaaccatttcttatcaataaatatctccgattcactg
tttttaacaagattggaaggtttaaatgatctgcacaaacaactagaagatcataaagaa
caaataatggaatttatgaaaaaatttcaggaaaatccaaaggactgtattatagtaaag
ttgatggcatatctgttacaactttcaaaaacaactgtacattctactgatactatcttg
gaggccgttgcaagttgtttgggagaaattggtcctataaatttttctaccatagcattg
cagcacagtaaaaatggatctaattccaatacgtgtgatctgtttgaagacagagaactt
cagtgggtctttgtaatattaactctcataaataattatttaatagatcaatgtattgaa
gttcgatcagctgctgctgccagtttgaaaaacattttagctaccaaaacaggacataca
ttttgtgaaaagtacaaaaccaagacagatacaatgctgatatacttgaatcctttcaga
acatctaagaaaaagctcttggaggtgcctggaaaggtaagagagactcctccagaagat
ctcgatcgtgcaatcttgtggattcctcacagtgaaagtcatgaaatttggattaagacc
ttgacttgtgcattattggatagtggaatgataacaagtgaaatcctcctgttgctgaag
cctttgtgtcaggttcatgctgatttctgtcaaactgtccttccttatttaattcatgat
atcctactgcacgactcaaatgaatctggacacagtcttctgtctgcacaaattcaatcc
tttttcatgacctgttgcaaatactcgtcacccagtagatcgtccacgcctgcaaattta
gattcagagtcagaaactccagctcatggacatttggataaaatatctcgaagaacaatg
cttgctgtggttgactacttaagacggcaaaaaaagaatccttccagtaccatctttgat
gacagcttctggctggaattaagctatctgcaagttgccatggtagcccagtcttgctca
gctcacttcacagctttgctctatgcagaaatctatgcagacaagataggcagacaacag
gaaaggtagtcaactaagaaactaacatttgaagaaggaagtcagaattcaacatttact
tgtttaagtgagaagagtaaagaagaaactggaataagtttgcaggaccttcttatggat
atatacagaagcataggagagccagatagtctctatggctgtggtggaggaaaaatgctg
cagccattgcccaggataagaacatatgaacacgaaggaacatgggggaaagctctggta
acttatgaccttgaaaccagccttccaccatcaattcgacagacaggattggtagaggct
ttgcagaattatgggctatgtaatacactctccatctacttaaaaggattggaacagcag
aatgaagaaagctccatagaattacaggagattcgttaccaggcagcttggaggaatatg
cagtgggatcagatctcctcagtcaaagatgaaatagagcaaagaggctaccatgaatca
ctgtatgatgctctacaatgtctacgggacagagatttttctactttttatggaagattg
aaatgtgccagaatcaaagaagtagaagagctactgaaaggcagtcttgagtctgtatat
tcattactgcctacgctgtgtaggctacagacaattggagagctggaatatgtaggacaa
cttttctctgggtattttactatttctttatacattattttagctttgcagaattatggg
ctatgtaatacactctccatctacttaaaaggattggaacagcagaatgaagaaagctcc
atagaattacaggagattcgttaccaggcagcttggaggaatatgcagtgggatcagatc
tcctcagtcaaagatgaaatagagcaaagaggctaccatgaatcactgtatgatgctcta
caatgtctacgggacagagatttctctactttttatggaagattgaaatgtgccagaatc
aaagaagtagaagagctactgaaaggcagtcttgagtctgtatattcattactgcctacg
ctgtgtaggttacagacaattggagagctggaatatgtaggacaacttttctctgggtca
gaaactaatagccagttgcataatttgcatctgaagtggcagaagcagtcccaacttctt
caagatagtgactttgctttccaagagcctattatggctttgcgtacagtaattctcaag
attcttctggagaaggaaaatgagaatgtccaaagggaatgcattaaaaacatcctcact
gaacatcttgtggaactatccagattggctcgaatggcgaataattcacaaaaactgagc
ttgtcagctggaaaactaacagcctgggttcaagaactgacagaggagcataaagttcag
actagtagatacactgtgaaagttcagagggagctggaaatagacgaatgtgaaattcgt
gctctgggagaagatcgcaagcgttttttatgcaaagcagttgagaactacattatgtgt
ttattgagtggagaagagcatgacatgtggatcttccgcctctgttctctctggcttgag
aacgctggactttctgaagtcaatgacatgattcagaaggaggcacagaaaatcccgtct
tacaaattcttgccactgatgtaccagctggctgctcgaatgggaaccaggatgagtgga
tttcatgaaattttgaataatcttatagcaagaatttctctcgaccatccacatcacact
ttgtttataattttggcattggctaatgccaacaaagatgaattcctggccaaaccagaa
gtgactaaaagaagtggactaataaaaaatgtgccaaaggaaacatctcttcttgacaag
gatcgaatgaaggctgctagcagtataattaacattgtaaaacgcaaaaaacctgatatg
gtggcaaaggttgaagccctttgtgatgcttatattattttggcaaacatggatgcaact
ccctggaaaacccacagaagaggcataaatattccttccgatcaacctataactaagtta
aagaatctagaagatgttgctgtacctaccatggaaattaaggtggaccctagtggcaaa
tatgaacatttgattacaataacatcattcaaaccagaatttcgcctagcaggcggggtc
aatctgcccaaaataatagattgtgttggttcagatggacaacagagaaggcagcttgtg
aaggggcgtgacgatctgagacaggatgctgttatgcaacaggttttccagatgtgcaac
actctactacagcaagatgctgacaccagaaagagaaaactgaccatccgcagatacaag
gttgttcccctttctcagagaagtggcgtcttagagtggtgcactggcacaattcctttg
ggggaattcctcatcaatactgacagcagtgctcacaaacgctatagaccacaagactac
agtagcatagactgtcaaaggaaaatgattgatgcacaaaagaaagattttgaagaaaaa
tacacagttttcatggatgtatgccagaattttcaacctgtatttcgctatttctgtatg
gaaagatttttggatccagcggtgtggtttgagaaaaggttggcatacactcgaagcgtt
gccacttcatctatagtcggctacatacttggtctaggagacaggcatgtacagaatatt
ctgttagatgaagaaagtgcagaactcgtacacattgatctaggagttgcttttgaacag
ggcaaaatccttcctactccagagactgtaccttttaggctaacaagagatgtagtggat
ggcatgggcattgctggtgttgagggggtcttcaggagatgctgtgaaaaaaccatgaat
gttatgagaaattctcaagaagccctgctaactattgtagaagttcttctatatgaccct
ctgtttgactggaccatgaaccctttgaaagctttatatctgcagcaaaggtcagaagat
gaagctgatgtcagctccaacttcagtagtgctgatcaaggatgtaacaaaaaatcaaat
aatgaaagccagttgttcaacaaagtggcagagcgtgtcttgatacgacttcaggagaaa
cttaaagggatggaagaaggtacagtgctcagcgtggccggccaggtgaacttcctcata
cagcaagccatggaccccaaaaatcttagccgcctcttcccaggatggaaaccatgggta
tga

DBGET integrated database retrieval system