KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107284867
Entry
107284867         CDS       T05763                                 

Gene name
ADCY3
Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00230  Purine metabolism
pmur01100  Metabolic pathways
pmur04020  Calcium signaling pathway
pmur04114  Oocyte meiosis
pmur04261  Adrenergic signaling in cardiomyocytes
pmur04270  Vascular smooth muscle contraction
pmur04371  Apelin signaling pathway
pmur04540  Gap junction
pmur04912  GnRH signaling pathway
pmur04914  Progesterone-mediated oocyte maturation
pmur04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107284867 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107284867 (ADCY3)
   04020 Calcium signaling pathway
    107284867 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107284867 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107284867 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107284867 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    107284867 (ADCY3)
   04916 Melanogenesis
    107284867 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107284867 (ADCY3)
   04270 Vascular smooth muscle contraction
    107284867 (ADCY3)
Enzymes [BR:pmur01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107284867 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 107284867
NCBI-ProteinID: XP_015668472
LinkDB
Position
Unknown
AA seq 1142 aa
MPRNRAFSEPEYSVEYSADYSVSLPSDPEHGVGRTHEVTVRNSGSCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVIIMCTVVYTSEKLAPTVAASVGLAAQIL
LFILCKYELLPDRVTRKFMPYILWILIAAQIFCYLGLNFACYHEASDTVGWQAFFVFSFF
LTLPLHLMPIVLISAISCGIHTLVLGVTIAQQKQQQLESIYGIVLLWQILSNVAVYLCTI
CVGIMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPRHVADEMLKDMKK
DASQKEMQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAR
YHQLRIKILGDCYYCICGLPDYREDHAVCSIMMGLAMVEAISYVREKTKTDVDMRVGVHS
GAVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMNCLKGEFEVEPGDGGS
RCEYLKEKGITTYLIVVPKQPLKNGINGVKLSVSSSHGNSPQLINTKECNGSINTTCTTP
DEAEESDTRVVNPSFPNPRRRLRLRDLAERVVDASENEQELNKLLNEALLERESVQALKG
RSTYRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTAMVEIFIDPRLLANYVTFV
VGEILLLILTLCSLAAIFPRVFPKKLVSFSTWIDRTRWARNTWAMSAIFILTMADIVDML
SCQQYYTIVNNTVPAVLPGGCVENPKYYSYIAVLALIATIMLVQVSHMVKLTLMLMITGA
VGVVNILAWQQIFDRYDQERFQENMXEISRSKMSWERVXGNIGLRSYLKXKEANNNLFTI
LLLLVCIALLNYLINFNVEKLARILFLWKIDVHSQKERVYEMRRWNEALVTNMLPDHVAR
HFLGSKKRDEELYSQSYDEIGVMFASIPNFADFYTEESINNGGIECLRFLNEIISDFDAL
LDDPQFRCITKIKTIGSTYMAASGVTPDVNINGYNTVKKEDLSEKERWQHLADLADFALA
MKETLMNINYQSFNNFMLRIGMNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGN
IQVVEETHFILKEYGFRFVRRGHIYVKGKGDLLTYFMKGREKQGSFINGSCVTLPHQVVD
SS
NT seq 3429 nt   +upstreamnt  +downstreamnt
atgcctcggaatagggcattctctgagcctgaatactcagtagagtattctgcagactat
tcagtcagcttgccttctgacccggagcatggggtcggccggacccatgaggtgacggtg
aggaactcaggttcttgcctctgtctgccccgttttatgcgactcacgttcgcccctgag
tccttggagaacctctaccagacctacttccggaggcagcgtcatgagactttgctggtc
ctggtggtctttgcagccctctttgattgctacgttatcatcatgtgcacagtggtgtac
acttcagagaagctggcacctactgtggcagcgtcagtgggcctggctgcccagatcctc
ctctttatcctatgcaagtatgaactcctgcctgatcgtgtcacccggaaattcatgcca
tacattctgtggatactgatagctgctcagatattctgctacttgggcttgaattttgcc
tgctaccacgaggccagtgacacagttggatggcaggccttttttgtcttctccttcttc
ctcaccctccccttgcatctgatgcccattgtccttatctcagccatttcttgtggcatc
cacacgcttgtgttaggagtcaccattgcacagcagaagcagcaacagctggagtccatc
tatggaatcgtcttgctgtggcagatcttatccaatgttgctgtctatctgtgcactatc
tgtgtgggtatcatgtcttactacatggcagaccgcaagcaccgcaaagccttcctagaa
gctcggcaatctctggaggtcaagctcaaccttgaggaacaaagtcagcagcaggaacgg
ttgatgctttcaattttgcccagacatgtagcggatgaaatgctgaaggatatgaagaaa
gatgcaagccaaaaagaaatgcaacagttcaataccatgtatatgtatcgccatgaaaat
gtcagcatcctttttgctgacatcgtaggttttacgcagctgtcatccgcatgcagtgcc
caagaattggtgaaacttttgaacgaactctttgctcgatttgataaactagcagctaga
taccatcaactgcgtatcaagattctaggtgactgctactactgcatctgtggattgcca
gactatcgtgaggaccatgctgtttgctcaatcatgatgggtcttgctatggtggaagct
atttcctatgtaagagagaagaccaaaacagatgtggacatgcgtgtgggggtgcacagt
ggtgctgtccttggtggagtcctagggcagaaacgttggcagtatgacgtatggtccaca
gatgtaactgtagctaacaagatggaagcaggcggcatccctgggcgtgtacacatttct
cagagcaccatgaactgcttaaaaggtgaatttgaagtggaaccaggagatggtgggtca
cggtgtgaatacctaaaggaaaaggggatcaccacctacctcatagtagtaccgaagcag
ccactcaagaatgggatcaatggggtgaagttatctgtctcatcctctcatgggaactca
cctcaattgatcaacaccaaagaatgcaatgggagcattaatacaacctgcacaactcca
gatgaggcagaagaatcggatactagggtagtgaatccttcctttcccaaccctcgaagg
cgtcttcgcttacgtgacttggccgagagagtggtggatgcctcagaaaacgagcaggaa
ctcaataagttgcttaatgaggccttgctggagagggaatctgtgcaggcgctaaaaggc
aggtccacctatcgcctatccatgcgtttcattgatcctgagatggagacacgttactct
gtggaaaaggagaagcagagcggggctgccttcagctgttcatgtgtggtcctgttcttt
actgctatggtggagatcttcattgatccacggctgctagcaaattatgtgacatttgtt
gttggcgaaatccttctactcatcttgactctctgttcacttgctgccatctttcccagg
gttttccctaaaaagctcgtgtctttttccacatggattgacagaactcgttgggccagg
aacacctgggctatgtctgccattttcatcctaaccatggctgacattgtagatatgctc
agctgccagcagtattacactattgtcaataatacagttccagcagtgcttccaggtggt
tgtgtagagaatcccaaatactacagctacatagcagtgttggcactcattgcaacaata
atgctggtgcaagtcagccacatggtcaagctcactctgatgttgatgatcacaggggca
gtgggagtggtcaacattctggcctggcaacagatctttgacagatatgatcaggagcga
ttccaggagaacatgtaagaaatttcaaggtcgaaaatgtcatgggagcgtgtttagggt
aatattgggcttaggtcatatctgaagtgaaaagaggctaataataacttgttcactatt
ttgttacttttggtatgcattgctcttttaaattatttaattaattttaatgtagaaaag
ttggctaggattttattcttatggaaaattgatgttcatagccagaaggagcgtgtgtac
gagatgcggcgctggaatgaagctcttgtcaccaacatgctgccagatcacgtggcacgc
cattttcttggctctaagaaacgagatgaggagctgtatagtcagtcttacgatgaaatt
ggtgttatgtttgcctctatccccaactttgccgacttctacacagaggaaagtataaat
aatggtgggattgagtgccttcgcttcctcaatgaaataatctcagattttgatgcgctc
ctggatgatccccagttccgatgcatcactaaaatcaaaaccattggcagtacatacatg
gcagcttctggtgtgacacccgatgtcaacatcaatggttacaacactgttaagaaggaa
gatctttcagaaaaggagcgctggcaacatttggcagatcttgcagactttgccttagcc
atgaaagagaccttgatgaacattaactatcagtccttcaataacttcatgctgcgaata
ggcatgaataaaggagcagtgctagcaggggtgattggtgcccgtaaacctcactatgat
atttgggggaacactgtgaatgtggcaagccggatggagtccacaggtgtcatgggaaat
atacaggtggtggaagaaactcactttatcttgaaagagtatggcttccgctttgtgcgt
cgagggcacatttacgtcaaaggcaaaggtgacttgctgacctattttatgaaaggacgt
gaaaagcaaggttcctttatcaatggttcatgtgtgactttgcctcatcaggtggttgac
agttcttga

DBGET integrated database retrieval system