KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107284993Help
Entry
107284993         CDS       T05763                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04010  MAPK signaling pathway
pmur04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107284993 (CACNA1E)
   04020 Calcium signaling pathway
    107284993 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pmur04040]
    107284993 (CACNA1E)
Ion channels [BR:pmur04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107284993 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 107284993
NCBI-ProteinID: XP_015668618
LinkDB All DBs
Position
Unknown
AA seq 2300 aa AA seqDB search
MARFGEAMAGRLGSGDGAMEQNRNRQGAPASSGGTPGAYKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFVFHKGSYLRNGWNVMDFIVVLSGILATAGAHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHQACYVNNSGELQELDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRNRT
EAMNRDSSDERVDISSVGTPLARSSIKSAKLDGASYFRHKERLLRISVRHMVKSQVFYWL
VLGIVALNTACVAIVHHKQPAWLTHLLNYAEFIFLGLFLLEMSLKMYGMGPRLYFHSSFN
CFDCGVTVGSIFEVVWAIFRPGTSFGISVMRALRLLRIFKVTKYWASLRNLVVSLMSSMK
SIISLLFLLFLFIVVFALLGMQLFGGRFNFMDGTPSANFDTFPAAIMTVFQILTGEDWNE
VMYNGIRSQGGVSSGMWSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEE
AFNQKHALQKAKEVSPMSAPNMPAIERDRRRRHHMSMWEPRTSNLRERRRRHHMSVWEQR
TSQLRRHMQMSSQEGINKDDPPLLNPHASIFRKRNLPESSGPEKIEGDQGSRPEETNREG
LEQKLPGSKPCPSNRDDQRSPSPQAKREWETWHHKSFHGNCDINDQESKGSVSFDERARL
RQSQRRSRHRRVRTEPKENRTVSQENGPEGVMPAKGEQNGDRKENGEEKEAVAEKEPVAD
MELKSKNSVLSNNRGKGVEATANNAELPMPTQDPSPSEGHQMLDKSKEASPVKQDGSSLE
ISEQALLGDLSMETERTISRSEPDLSSITANMDKATESTTIMIDVQDSTVVQISNKTDGE
ASPLKEAETKEEEETETEKKNKKRKKEKSSETGKPMVPHSSMFIFSTTNPIRRACHYIVN
LRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLI
LQDGSYFRDLWNILDFIVVVGALMAFALANALGSNKGRDIKTIKSLRVLRVLRPLKTIKR
LPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKDCIG
NYIDHEKNMMEVKCRQWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGP
SRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAI
SAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTYELALK
YLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKPTVTSSFN
MSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGN
IKLDEESHINRHNNFRSFLGSLMLLFRSATGEAWQEIMLSCLEGKGCEPDTTATSGQNEN
EKCGTELAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEY
DRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDNTVHFTSTLMA
LIRTALDIKIAKGGADWQQLDSGLQKEILTIWPHLSQKMLDLLVPMPKTTDLTVGKIYAA
MMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDTISGLNS
RSGFPSLSPLSPQEIFQLACMDSAHGEYQEQQSLEPEIRELKRVQPSNCGSYLPVDTQER
AVSGRASSMPRLTVDPQVVTDPGSMRRSFSTIRDKRTNSSWLDEFSMERSSENTYKSRRR
SYHSALHLSSRRLNTDSGHRSDTHRSGGRERGRSKERRHLLSPDISRCNSEERSPQADID
SPERHHSRSPSEGRSQTPNRQGTGSLSESSIPSLSDTSTPRRSRRQLPPVPPKPRPLISY
TAMMQHCGDTSPPPDDSEGGSPLLSGTLETNNACLTESSSSLQGKQSLLSTPQRYISEPY
LMLQDDSHASDCGEEETLTFEAAVATSLGRSNTIASGPRSRHGWQMPNGHYRRRRRGASQ
SMIYGAGIEVLSDTEEDDKC
NT seq 6903 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcttcggtgaggcaatggctggcaggctgggatctggagatggagccatggaa
cagaacaggaaccgccagggagcccctgcttcttcagggggaaccccaggagcatataag
caaactaaagctcaacgggccaggacgatggcattgtacaatcccatacctgtccgccag
aattgcttcacagtcaacagatctctcttcatctttggggaagataacattgtcaggaaa
tatgccaagaagctcatcgactggcctccttttgaatacatgattctggcaaccatcatt
gcgaactgcatcgttttggccttggagcagcatctccctgaagatgataagacacctatg
tctcgcagattagaaaaaacagaaccttattttattgggatcttttgctttgaagctggc
attaaaatagttgcattgggattcgttttccataagggatcatacctgcgaaatggatgg
aatgtcatggatttcattgtggtcctaagtggcatccttgcaacagcaggagcacatttt
aacacccatgtggacctgcggactctgcgggcagtacgcgtgctcagacccttgaagctt
gtctcaggcattcctagtttacagattgtactaaagtccatcatgaaggcaatggtgcct
ctgcttcagattggtctccttctcttttttgcaatcctgatgtttgccattatcggcctg
gaattttacagtggaaaactacatcaggcttgctatgtaaacaattcaggtgaattacaa
gagctggacccgccacatccctgcggggtgcagggatgccctgcaggttatgagtgcaga
gactggattggtcccaatgatgggataactcagtttgacaacatcctctttgctgtgttg
actgtcttccagtgcattaccatggaaggatggactacagtgctgtacaataccaatgat
gccttaggagccacctggaattggttgtacttcattcccctcatcatcattggatcgttt
tttgttctcaaccttgtcctgggagtgctttctggagaatttgccaaagagagagagcga
gtggaaaatcgccgagctttcatgaaactgaggagacagcagcagattgagagggagctg
aatggctaccgggcctggatagacaaagcagaggaagtgatgctggctgaagagaacaaa
aattctggcacatcagccttagaagtacttagaagagcaactattaaaaggaaccggacg
gaagccatgaatcgtgattctagtgatgagcgtgtggatatctcatctgtgggaacccca
cttgctcgatccagcatcaaaagtgcaaaattggatggggcctcatacttccgacacaag
gaacgcctcttgcggatctctgttcgtcatatggtgaaatcccaggtgttctattggctt
gtcctgggcatagtggccctcaacactgcttgtgtggctattgtccatcacaaacagcct
gcatggcttacacatctgctaaactatgcagagtttatatttctgggcctgttcctccta
gagatgtccttgaagatgtacggaatgggaccacgtctttatttccattcttctttcaac
tgttttgactgcggggttacagtggggagcatctttgaagtagtttgggctatctttaga
cctgggacctcttttgggattagtgtcatgcgagccctacgacttctacggatctttaaa
gtcacaaagtattgggcttccttgaggaatttggtggtctctctgatgagttctatgaag
tctattatcagcctgctcttcctccttttcctcttcattgtagtctttgctctacttgga
atgcagctttttggtggcagatttaattttatggatggcactccttcggcaaattttgat
acctttcctgcagccatcatgacagttttccagatattaacaggtgaagattggaatgaa
gtgatgtacaatggaattcgctctcaaggtggtgtcagctcaggaatgtggtcatccatc
tacttcatagtcctcacattatttggaaactataccctacttaatgtattcttggccatt
gctgtggacaacctagccaatgcacaggaactgacaaaggatgagcaggaggaagaagag
gctttcaatcaaaagcatgctctacagaaagccaaagaagtcagtccaatgtctgctccc
aacatgcctgctatagaaagagacagaaggaggagacaccacatgtcgatgtgggaacca
cgtaccagtaatctgagggagaggagaaggagacatcacatgtctgtgtgggaacagcgg
actagccagctccgccgacatatgcagatgtccagtcaagagggcatcaacaaagatgat
cctcctctgctcaatccacatgccagtatttttcgcaaaagaaatttaccggaaagctct
ggtccggaaaagattgagggtgatcaagggagtaggccagaggagacaaacagagaaggt
ctggagcaaaaactcccagggtccaaaccctgccccagcaaccgggatgaccagagaagc
ccatctcctcaggccaagagggaatgggaaacgtggcatcacaaatcatttcatgggaat
tgtgatatcaatgaccaggaaagcaaagggagcgtaagctttgatgaaagggctcggctc
cggcagagtcagaggcgtagccgacaccgcagggtgaggactgaaccgaaagagaataga
acagttagccaagagaacggcccagaaggagtcatgccagcaaaaggagaacaaaatggg
gatcgtaaggaaaatggagaagaaaaagaagccgttgctgaaaaggaaccagtggctgac
atggaactgaaaagtaaaaactcagttttgtcgaataatagggggaagggggttgaagca
acagcaaataatgccgaacttcccatgcctacccaagatccaagtccctcagaaggtcac
cagatgttggacaaaagcaaggaggccagtccagtgaagcaagatggcagcagcctagag
ataagtgagcaagcgcttttgggtgacctatcaatggagacagagaggactatcagcagg
agtgagcctgatctttcatctatcactgccaacatggataaagcgacagagagcactacc
atcatgattgatgttcaagactccactgtggtacagattagcaacaagacagatggagag
gccagtccgctgaaggaggcagaaacaaaggaagaggaagagacagagacagagaagaag
aataaaaagcgaaaaaaggagaagagctctgagacaggcaaaccaatggtgccccacagc
tccatgtttattttcagcaccacaaacccaatccgaagagcttgccactacattgtcaat
ctgcgctactttgagatgtgtatccttcttgtgattgcagcaagcagcatcgccttggca
gcagaggatcctgtcctgaccaactcagagagaaataaagtcctgaggtatttcgactac
gttttcactggcgtcttcacctttgagatggtcattaaaatgattgatcagggattaata
ctgcaagatggctcttactttcgggatctttggaacatcctggatttcattgtggttgtt
ggagcgctgatggcctttgctttggcgaatgctttggggtccaacaaaggtcgtgacatt
aaaacaatcaagtcccttcgtgttctacgcgtcttgagacctttgaagaccatcaagcgg
ttgcccaaactcaaggcagtctttgactgtgttgtaacttctctgaaaaatgtcttcaac
atactcattgtctacaagctcttcatgttcatctttgccgttatcgcagtccagcttttc
aagggcaaattcttctactgcacagacagttcaaaggatacagagaaagactgtattgga
aactatatagaccatgagaaaaacatgatggaagtaaaatgtcgacaatggaagcgccat
gaattccactatgataatatcatttgggctttgcttacactcttcactgtttccactgga
gaaggatggcctcaagttctacaacattcagtagatgtgactgaggaagatcgtggcccc
agccgtagcaaccgcatggaaatgtctattttttatgtggtttactttgtagtttttcct
ttcttttttgttaacatctttgtggctctcatcatcatcactttccaggagcaaggagac
aaaatgatggaagagtgtagccttgagaaaaatgagagagcctgcattgactttgctatt
agtgcaaaacccctcacccgctacatgcctcaaaaccgacacacttttcagtaccgagtt
tggcactttgtagtatccccatcatttgaatacaccattatggctatgatagctcttaac
actgtggttctaatgatgaagtactattctgctccatatacctatgaattggctctgaag
tatctgaatattgcttttaccatggttttctcattggaatgtgttctgaaaatcatagct
tttggtttcttgaattatttccgtgatacctggaacatatttgatttcatcaccgtgatt
ggcagtattacagaaattatcctgacggatagtaagccgacagttaccagcagcttcaac
atgagctttctgaagttgttccgggctgcccgtctcatcaaactgcttcgccaagggtat
accattcgaattctgctctggacctttgtgcagtcattcaaggctctcccatatgtctgc
cttctcattgcaatgctcttcttcatttatgcaatcattgggatgcaggtgtttgggaac
atcaagctagatgaggaaagtcacattaaccgtcacaacaatttccgcagcttccttggt
tctctcatgttactgtttagaagcgctacaggggaggcatggcaggagattatgctttca
tgcctagaagggaaaggttgtgagccagacactacagcaacatctggacaaaatgagaat
gagaagtgtggcacagaactagcatatgtctactttgtctccttcatcttcttttgctcc
ttcttgatgctcaatctctttgtggctgtcattatggacaattttgaatacctgactcga
gattcttccatcttgggaccccatcaccttgatgaatttgtccggatttgggcagaatat
gatagagctgcatgtggccgcatccattacactgagatgtatgaaatgctgactctcatg
tccccaccactaggcctcgggaagagatgtccctccaaagttgcttataagagactggtc
ctgatgaacatgccagtggctgaagacaacacggtgcatttcacttccaccttgatggca
ttaattagaacagctcttgatattaagatagcaaaaggtggtgcagactggcaacagtta
gactctgggctccagaaggagattctgaccatttggcctcacctttctcagaagatgcta
gatctattggtacccatgccaaaaactacagacctgacagttgggaaaatctatgcagcc
atgatgataatggactactataagcagagcaaagctaaaaagcaaagacagcagctggaa
gaacagaaaaatgccccaatgttccagcgcatggagccttcatctcttcctcaggagatc
atttccaatgccaaagctttgccttaccttcagcaagacactatttcaggactgaacagc
cgtagtggattcccctccctgagtccactctctccccaagagatattccagttggcatgt
atggattcagcccatggagagtatcaagaacagcaatctctggagccagaaattagagag
cttaaaagagtgcagccctctaactgtggcagttatctcccggtggatactcaggaacga
gctgtatctgggagggcttcttccatgccacgcctgactgtggatccccaggtagtaaca
gatcctggctccatgagacgctcattttctaccatccgagataaacggacaaattcctcc
tggctggatgagttctcaatggaaaggagcagtgaaaatacctacaagtctcgtcgtcgc
agttaccattctgcactgcacctgtcttcacgccgtctcaacacagactcaggccatcga
tctgatacacatcggtcaggaggcagagaacgaggccgatccaaggaacgaagacatcta
ctctctccagatatttctcgttgcaactcagaggaaaggagtccacaagcagatattgat
tctccagagcgacatcattccaggtctcccagtgaaggcaggtcacaaactcccaacaga
cagggcacaggctccttgagcgagagctccatcccttctctgtctgacaccagcacacca
aggcgaagccgccgtcagctccctccagtgccaccaaagccacgacccctcatctcctac
actgctatgatgcagcactgtggtgacacctccccaccacctgacgacagtgaggggggc
tcccctctgctttctgggactctggagacaaacaatgcctgcttgactgagtcttccagc
tccctccagggaaagcagagccttctctccactccccagcgctacatctcagagccttac
ctgatgctccaggatgactcccacgcttcagactgtggtgaggaggagacactcactttt
gaggctgctgtggccactagccttggccgctccaacacaattgcatcggggccccgctct
aggcatggttggcagatgcccaatgggcattaccggaggaggagaagaggagcgtcacaa
agcatgatatatggggctggcatcgaagtactaagtgatacggaagaagatgacaagtgc
tag

DBGET integrated database retrieval system