KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107284999
Entry
107284999         CDS       T05763                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107284999 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pmur04052]
    107284999 (EPO)
Cytokines and growth factors [BR:pmur04052]
 Cytokines
  CSF and other factors
   107284999 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 107284999
NCBI-ProteinID: XP_015668627
LinkDB
Position
Unknown
AA seq 200 aa
MAKPDKESVNTAGREVRAEVGMWGRGGLIPFLLVWASLDPALPAPAQPICDQSVMNKFIQ
DASKMEKDIVDLCEDACNLPEHVTVLDTRVNFPDWPAMDRSRQASEVWRGQALLSVAVGH
VKSQQPRMQPFLRQLEVMESGLRSIREILRRHNAQADPQEEPLLRTLSVQTVQKLFSVYS
SFLRGKVNLFLASACQASGR
NT seq 603 nt   +upstreamnt  +downstreamnt
atggccaagcccgataaggaatctgtcaacacggcaggccgagaggtgagggctgaagtg
ggcatgtggggcaggggagggctgattccatttctgttggtgtgggcatccttggacccg
gccctgcccgcccctgcccagcccatctgcgaccagagtgtcatgaacaaattcatccaa
gacgccagcaagatggagaaggacattgtggacctttgtgaagatgcctgcaacttacca
gaacacgtgacggtgttggacaccagggtgaattttcctgactggccagcgatggacagg
tccaggcaggcctcggaggtgtggcggggccaggcgcttctctccgtcgccgtgggccac
gtcaaaagccagcagccccggatgcagcctttcctgcgccagctggaggtgatggagagc
ggcttgagaagcatccgtgagattctgcgcaggcacaacgcccaggcagacccccaggag
gagcccctccttcggacattgagcgtgcaaacggtgcaaaaactcttcagcgtatattcc
agtttcctgcgtgggaaggtcaacttgttcctggccagtgcctgccaggcgagtggcagg
tga

DBGET integrated database retrieval system