KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107285325Help
Entry
107285325         CDS       T05763                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03030  DNA replication
pmur03410  Base excision repair
pmur03420  Nucleotide excision repair
pmur03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107285325 (LIG1)
   03410 Base excision repair
    107285325 (LIG1)
   03420 Nucleotide excision repair
    107285325 (LIG1)
   03430 Mismatch repair
    107285325 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pmur03032]
    107285325 (LIG1)
   03400 DNA repair and recombination proteins [BR:pmur03400]
    107285325 (LIG1)
Enzymes [BR:pmur01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107285325 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     107285325 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107285325 (LIG1)
DNA replication proteins [BR:pmur03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107285325 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107285325 (LIG1)
DNA repair and recombination proteins [BR:pmur03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107285325 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     107285325 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     107285325 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DDR
Motif
Other DBs
NCBI-GeneID: 107285325
NCBI-ProteinID: XP_015668989
LinkDB All DBs
Position
Unknown
AA seq 944 aa AA seqDB search
MQSNIRSFFQPLARIKSEKEKAEDSHMEDARIKSEKEKAEDSHMEDARIKSEKEKAEDSH
MEDVLISQKKLINGPELGEDFPVNSASKKVAKVLKSDDEEDSVELDGKDALADDNKLSPD
CVSEQKISEASISPSTSPTTTNSITSFSIPRRKTARKQLSKRKPQEEDNSYNFHESRSTK
RWKEDLDRDDSKDKTNEKPMEVEEVKSENAKLVQHKTDRNAKEKKISDSSKPSSKSISSF
FAPKKSSVNIEKKQTTVVSENMAVPKCLNKVNNDESNSMADNFLKPSFTLEPAEYNPTKS
TYHPIHNACWGPGQKIPYMALARTFEYIEEESARLKIIETLSNLFRSAIVLSPQDLLPCV
YLCLNQLGPAYEGLELGIGKTILMRALAQATGRQLDQIKAEAAEKGDLGLVAENSRTTQG
TVFAPPKLSAAAVFGKLQAIGHMAGSSSMNKKIDIIKSLFVACRHSEARYVARSLEGKLR
IGLAEQSVLSALAQAASLTPPGQKFPPDVLDAAKGKSADARKAWLDERALIVKQAFCELP
NYDIIVPVLLEHGVESLPQYCKITPGIPLKPMLAHPTKGIGEVLKRFEEAAFTCEYKYDG
ERAQIHILENGEVHIYSRNQENNTTKYPDIVTRVPKVKNSTVKSCILDAEAVAWDPVAKH
ILPFQVLTTRKRKDVDAAEIRVQVCIYAFDMLYLNGTSLVQKPLSQRRTLLHNSFTEVEG
QFLFATSMDTSDVDEIAEFLECSIKDSCEGLMVKTLEVDATYEIAKRSHNWLKLKKDYLE
GVGDTLDLVVIGAYLGKGKRAGTYGGFLLACYDEESEEFQGICKIGTGFSDEVLEKLHSS
LKDYVIPQPRPYYRWGGIAEPDHWLEAQHVWEVKCSDLSISPIHRAASGLVDEEKGISLR
FPRFLRIRDDKKPEEATSSAQVAELYRKQQQIQNQLPLEKDDFY
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcaacataagatcattcttccagcctctggcacgaataaagtctgaaaaagaa
aaagcagaagacagccacatggaagatgcacgaattaagtctgaaaaagaaaaagcagaa
gacagccacatggaagatgcacgaattaagtctgaaaaagaaaaagcagaagacagccac
atggaagatgtgcttatttcacaaaagaaattaataaatggtccagaactcggtgaagac
ttcccagtgaattctgcatcaaaaaaagttgctaaggtccttaagagtgatgatgaagaa
gattctgtggaattagatggaaaggatgcactagcagatgacaacaagttgagccctgac
tgtgtttctgagcaaaagatctctgaagcgagcatctctccaagtaccagcccaactacc
accaattcaatcacatctttcagtatcccaaggcgcaaaactgcccgcaagcaactctct
aaacgtaaaccacaggaagaagacaacagttataatttccatgaaagccgcagtaccaaa
cgatggaaggaagaccttgatagagatgattctaaagataaaactaatgagaaacccatg
gaagtggaagaagtgaaaagtgaaaatgcaaaattggtgcagcataaaacagacagaaat
gcaaaggagaaaaaaatctcagattcctctaagccatccagcaagtccatttctagtttt
tttgctcccaagaaaagttctgtgaatatagaaaagaagcaaacaactgtagtatcagaa
aacatggcagtaccaaagtgtcttaataaagttaataatgatgagtccaacagcatggct
gacaattttctcaagccatcatttacacttgagcctgcagaatacaatcctacaaagagc
acttatcatcctattcataatgcttgctggggccctggccaaaagataccatacatggct
ttggctcgtacttttgaatatattgaggaggaatctgcccggttgaaaattatagagacc
ctaagcaatctctttcgttctgcgattgtcctatctccacaagacctgctcccctgtgtc
tatctctgtctcaatcagttaggcccagcatatgagggcctagaattaggcattggcaaa
accatcctcatgagagctctggcccaggccacaggtcgccaattggaccaaatcaaggca
gaggcagcagagaagggagatctaggtttagttgctgaaaacagtcgtacaacacaagga
actgtgtttgctccacccaaacttagtgctgctgctgtctttggcaaactgcaagcaatt
ggtcatatggcaggaagctcttctatgaacaagaaaattgacattatcaaatctttgttt
gttgcatgtcgccattcagaggctcgttatgtggctcggtcccttgaaggaaagttacgg
attgggctagcagagcagtctgtcctctcagctcttgcccaggcagcatcactcactccc
ccaggacaaaaatttcccccagatgttttggatgctgcaaagggcaaatcagcagatgca
cgcaaagcttggctggatgaaagggccttgattgttaagcaggccttctgtgaactacca
aattatgacatcatagtacctgtccttttggagcatggtgtggagagcttgcctcagtac
tgcaagatcactccagggattcccctgaagcccatgctggctcacccaaccaaaggaatt
ggggaggtattaaagcgttttgaagaagcagctttcacttgtgaatacaaatatgatggg
gagcgggcacagatccacattctagagaatggagaagtacatatttatagccgaaaccaa
gagaacaacacaacaaagtaccctgatattgtcacccgtgttcccaaggtgaaaaacagc
actgtgaaatcatgcattttggatgcagaggcagtggcctgggaccctgttgcaaaacat
atccttccattccaagtattgaccacccgcaagcgcaaggatgtggacgctgcagaaatc
cgagtgcaagtttgtatatatgcatttgacatgctttaccttaatggaacgtctttagtc
cagaaacctctgtctcagcgccggacattactgcataattctttcactgaggttgaaggc
caattcctttttgccacttccatggatactagtgatgttgatgagatagcagaatttctg
gaatgctctatcaaagactcatgtgaagggttaatggtgaaaacactcgaagtagatgcc
acatatgaaattgcaaagaggtcacacaattggctgaagcttaaaaaagattatctggaa
ggtgttggtgatacccttgacctggtggtgattggtgcctacttgggcaagggcaaacgg
gcaggcacgtatggaggtttcctcctagcatgttatgatgaggaaagtgaagaattccag
ggcatctgcaaaattggcacgggattctcagatgaggtcttagagaaacttcatagctca
ctcaaggactatgtgattccacagccacgaccatactatcgttggggtggaatagctgaa
cctgatcactggttggaagcccagcatgtttgggaagtgaagtgttctgatttatccatt
tctcccattcacagagcagcatcaggtttggtggatgaagaaaagggcatctccttacgt
ttccccagattcctgcgcatccgagatgataagaaaccagaggaagccactagcagtgct
caggtggctgaactttatcggaaacagcagcagatccaaaatcaactaccactggaaaaa
gatgatttctactaa

DBGET integrated database retrieval system