KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107285600Help
Entry
107285600         CDS       T05763                                 

Gene name
ERG
Definition
(RefSeq) transcriptional regulator ERG
  KO
K09435  transcriptional regulator ERG
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmur03000]
    107285600 (ERG)
Transcription factors [BR:pmur03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    107285600 (ERG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT SAM_3 SAM_2
Motif
Other DBs
NCBI-GeneID: 107285600
NCBI-ProteinID: XP_015669291
LinkDB All DBs
Position
Unknown
AA seq 478 aa AA seqDB search
MASTIKEALSVVSEDQSLFECAYGTSHLAKSEMTASSSSEYGQTSKMSPRIPQQDWLSQP
PARVTIKMECTSNQVNGSRSSPDNCSVTKSGKMTNTENVGMNYGNYMEEKHIPPPNMTTN
ERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVDIMLFQDIDGKELCKMTKDDFQRLTP
SYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEAT
QRMTTRPDIPYEPARRSAWTSHGHPAPQSKAAQASSSVVTKTEDQRPQLDPYQILGPTSS
RLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNMN
YDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSIYKYPSDLPYMSSY
HAHPQKMNFVAPHAPALPVTSSNFFAGPSPYWNSPTGSIYPNTRLPTTHMPSHLGTYY
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcactattaaggaagcattatcagtcgtaagtgaagatcagtctttgtttgag
tgtgcctacgggacttcccatcttgctaagtcagagatgactgcttcttcttccagtgaa
tatgggcaaacatcaaagatgagtccacgtatcccccaacaggactggttatcccagcct
ccagccagagtcaccataaaaatggaatgcacctcaaatcaagttaacggctcaaggagt
tcccctgacaactgcagtgtgacaaaaagtggaaagatgactaacactgaaaatgttggc
atgaactatggaaactatatggaagaaaagcacatccctccaccaaatatgaccaccaat
gaacgaagagttattgttccagcagatcctacattatggagcacagaccatgtacgccag
tggctagaatgggctgtgaaggaatatggcctcccagatgtggacatcatgctatttcaa
gatattgatggaaaggagttgtgtaagatgaccaaagatgacttccagaggctcacacca
agctacaatgcagacattcttctttcacacttacactacctcagagaaactcctcttcca
catttgacttcagatgatgttgataaggctttacaaaactctccacggttaatgcatgct
agaaatacaggaggtgcagcatttatttttccaaatacttcagtttatcctgaagcaaca
caaagaatgaccaccaggccagatataccttatgaaccagccagaagatcagcatggaca
agtcatggtcatcctgctcctcaatcaaaagctgcccaagcatcatcttcagttgtgacc
aaaacagaagaccagcgtcctcagttggatccttatcaaattcttggtccaacaagcagt
cgtcttgcaaatccagggagtgggcagatacagctgtggcagtttttgttggagcttctg
tcagatagctccaattctaattgcatcacctgggaaggtaccaatggagagttcaagatg
actgaccctgatgaagttgcacggcgctggggggaaaggaagagcaaacccaatatgaac
tatgacaagctcagtcgtgctcttcgttattattatgacaaaaatataatgactaaagtc
catggtaaacgttatgcctacaaatttgacttccatggaattgctcaagcccttcagcca
catcctccagaatcatccatctataaatacccatcagacctgccctacatgagttcctat
catgcacacccccagaaaatgaactttgttgctcctcatgctcctgctttgcctgttact
tcctccaacttttttgctggacccagtccatactggaattcaccaactggaagcatctat
cccaacactaggctcccaaccactcatatgccttctcatcttggcacttactactaa

DBGET integrated database retrieval system