KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107285821
Entry
107285821         CDS       T05763                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04068  FoxO signaling pathway
pmur04110  Cell cycle
pmur04115  p53 signaling pathway
pmur04218  Cellular senescence
pmur04310  Wnt signaling pathway
pmur04340  Hedgehog signaling pathway
pmur04371  Apelin signaling pathway
pmur04510  Focal adhesion
pmur04530  Tight junction
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107285821 (CCND1)
   04340 Hedgehog signaling pathway
    107285821 (CCND1)
   04371 Apelin signaling pathway
    107285821 (CCND1)
   04068 FoxO signaling pathway
    107285821 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107285821 (CCND1)
   04115 p53 signaling pathway
    107285821 (CCND1)
   04218 Cellular senescence
    107285821 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107285821 (CCND1)
   04530 Tight junction
    107285821 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107285821
NCBI-ProteinID: XP_015669559
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYQDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRYLSFEPIKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPNELLQMELLLVNKLKWNLAATTPHDFIEHFLNKMPVAEDSKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNSFLSYQCLTPFLSKVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEEEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctctgctgtgaagtcgagaccatccggagagcctaccaagatgcc
aacctcctcaatgacagggtcttgcagactatgctgaaagcggaggagacttgctcgccc
tccgtctcctacttcaagtgcgtgcaaaaggagatcttaccatatatgaggaaaatagtg
gcaacttggatgctggaggtttgtgaggaacagaaatgtgaagaagaagttttccccttg
gcgatgaattatttggaccgatacctctcttttgaacccatcaagaaaagccgcttgcaa
ctactcggagctacttgtatgttcgtggcttcaaaaatgaaggaaactattcctctaaca
gcagaaaaactgtgtatttacactgataactccattagaccgaatgaattactgcaaatg
gaactgcttctggtgaataagctgaaatggaatttggctgccacgactcctcacgatttt
attgaacattttctaaataaaatgcctgtggctgaggacagcaagcagatcatccgtaaa
cacgcccagacttttgtggctctctgtgcaacagatgttaagtttatttcaaacccacct
tccatgattgcagccggtagtgtggtagcagcagtgcaaggtcttcaccttggaaacact
aattcttttctctcttatcaatgtctcacacctttcctatcaaaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgaatctctccttgagtctagtctccgc
caggcacagcaacacaatgtatcttcagaaacaaagactgttgaagaggaagctgatctt
tcctgcacacccactgatgttagagatgtgaatatttaa

DBGET integrated database retrieval system