KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107286171Help
Entry
107286171         CDS       T05763                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5 isoform X2
  KO
K08015  Ras association domain-containing protein 5
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107286171 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RA Nore1-SARAH UN_NPL4
Motif
Other DBs
NCBI-GeneID: 107286171
NCBI-ProteinID: XP_015669967
LinkDB All DBs
Position
Unknown
AA seq 266 aa AA seqDB search
MTVHKSMSSGYCSLDEDLEECFFTAKTTFFRNPQSKLAAKNVTKTVEEAKPKPPTIQELK
EMISNYNSKVNNCLLMKLNDDGTYTGFIKVHLKLRRPVTVPAGIRPPSIHDALKEVNLAN
MTEKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKQMEKDGQVLS
RKLPVTECPLYLRLLAGPDTDILNFVLKENETGEVEWDNFSIPELQNFLLILEREEKDKI
QQVQKKYSRFKQRLQEALKEANGKPG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgactgtccataagagcatgagtagtggctactgtagtttggatgaagacttggaggag
tgtttttttacagccaaaaccacctttttcaggaatccccagagcaaacttgctgcaaag
aatgtaacaaagacagtggaagaagcgaaacctaaacctcctactatccaagaactgaaa
gaaatgattagcaattacaactcaaaagtcaacaattgtttgctgatgaagctgaatgac
gatggcacttacacaggtttcatcaaagtgcacctaaaactaaggcgtcctgtgacagtc
ccagcagggattaggccaccatctattcatgatgctctcaaagaagtcaatttagctaac
atgacagagaaaagaacatcattctatctacccttggatgccatcaaacagttacatatc
agcagcacaacaactgtgagtgaggtgatccagggacttctgaagaaatttatggtggtg
gacaacccacagaaatttgcacttttcaaacagatggagaaagatggtcaagttctttcc
cggaagcttccagtcacagaatgtcctttgtacctccggctcctagcaggccctgacacg
gatattctgaattttgtgttgaaggaaaatgaaacaggagaagttgagtgggacaacttc
tctattccagagctacagaattttttactaatactagaaagagaagaaaaagacaaaata
caacaagtacaaaaaaaatacagcaggtttaaacaaagactgcaagaagccttgaaagaa
gcaaatgggaagcccggataa

DBGET integrated database retrieval system