KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107286853Help
Entry
107286853         CDS       T05763                                 

Gene name
RHCG
Definition
(RefSeq) ammonium transporter Rh type C
  KO
K06580  ammonium transporter Rh
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmur02000]
    107286853 (RHCG)
   04090 CD molecules [BR:pmur04090]
    107286853 (RHCG)
Transporters [BR:pmur02000]
 Solute carrier family (SLC)
  SLC42: Rh ammonium transporter
   107286853 (RHCG)
CD molecules [BR:pmur04090]
 Proteins
  107286853 (RHCG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp DUF4293
Motif
Other DBs
NCBI-GeneID: 107286853
NCBI-ProteinID: XP_015670774
LinkDB All DBs
Position
Unknown
AA seq 467 aa AA seqDB search
MVRPSLMAKNTDMRWRLPLVCLLWEVAMIILFGIFVRFNPEANVADWEKEKQQRNISDIE
NEFYFRYPSFQDVHVMIFVGFGFLMTFLQRYGFGGVGFNFLLAAFGIQWALLMQGWLHTF
QHGKILIGVESLINADFCVGSVCIAFGAILGKVSPVQLLIMTLFQVTLFSVNEYILLDLL
HVKDAGGSMTIHTFGAYFGLTVTSILYRPNLEQTKEKQESVYHSDLFAMIGTLFLWMYWP
SFNSAISNHGDAQHRAAINTYCSLAACVLTSVAFSSLLQKKGKLDMVHIQNATLAGGVAV
GTAAEMMLTPYGALIVGFICGIVTTTGYVYITPFLDAKLHIQDTCGVHNLHGMPGLIGGI
VGAVTAAAATEGVYGKKGLTNMFDFTGEYQDRTPSIQGGFQAAGIAVSLAMALVGGAIVG
GILKLPFFGDPTDENCFEDNVYWEIMPEYLNVASKFYLKRDLEGKVA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcccgagcctgatggcgaagaataccgacatgcgctggcgcttacctttggtt
tgcctcctctgggaggtggccatgatcatcctttttgggattttcgtgcgcttcaacccg
gaggctaacgtggctgattgggagaaggagaaacagcaaaggaacatctccgatattgag
aatgaattctacttcagatacccctctttccaagatgtccatgtgatgattttcgtgggc
tttggcttcctcatgaccttccttcaacgctatggctttggcggtgttggcttcaacttt
ctcctcgctgcctttgggatccagtgggctctcctgatgcagggctggctccataccttt
cagcatgggaagatactcattggagtggaaagcctgattaatgcagatttctgcgtgggt
tctgtttgtatcgccttcggtgccattttgggcaaagtcagtcccgtccagctcctcatt
atgacactgtttcaagtgaccctcttctccgtcaatgaatatatcctgcttgatctgctc
catgtgaaagatgctggtggatccatgacaattcatacgtttggtgcttactttggccta
acggtgacctctattttgtaccggcccaacctggagcagaccaaagaaaagcaggaatct
gtttaccattcagacctttttgccatgattggcaccttgtttctgtggatgtactggccc
agttttaactccgccatttccaatcacggggacgcacagcaccgggcggccatcaacacc
tactgttcacttgctgcgtgtgtcctgacttcggtggctttttccagtctcttgcaaaag
aagggaaagttggacatggtccatattcaaaatgccaccctggccggaggtgtggctgta
ggaactgctgctgaaatgatgctgaccccatacggtgccctcattgtgggcttcatctgt
ggcatcgtgacgaccactggatacgtctacatcacacctttcctggatgctaagctccat
atccaagacacctgcggtgtccacaaccttcacggaatgccaggtttaattggaggcatt
gtgggggccgtcactgctgctgcggctacagaaggagtctacggaaagaaagggctcacc
aacatgtttgacttcaccggagaataccaggatcgaacgcctagcattcaagggggattc
caagcggctggcattgcagtatcactagctatggctctggtgggaggagctattgtaggt
ggcattttgaaactgcccttctttggcgaccctacagatgaaaactgctttgaagataat
gtctactgggaaataatgccagagtacctcaatgttgcctccaaattttatttaaaacgg
gatctagaaggcaaagtggcgtga

DBGET integrated database retrieval system