KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107286912Help
Entry
107286912         CDS       T05763                                 

Definition
(RefSeq) cationic trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107286912
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pmur01002]
    107286912
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmur04147]
    107286912
Enzymes [BR:pmur01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     107286912
Peptidases [BR:pmur01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107286912
Exosome [BR:pmur04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107286912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 107286912
NCBI-ProteinID: XP_015670841
LinkDB All DBs
Position
Unknown
AA seq 248 aa AA seqDB search
MKFIWLLALLGAAVAFPIDDEDDDKIVGGYTCQKHSVPYQVSLNSGYHFCGGSIIKSQWI
VSAAHCYKSRIQVRLGEHSLTKNDGSEQYIDSVKVIRHPSYNSQTLDNDIMLIKLSKPAT
LNSRVSAVNLPNSCPASGAKCLISGWGNTLSSGSSYPDLLQCLTAPILSQSQCSKAYPGK
ITNNMFCAGYLEGGKDSCQGDSGGPVVCNGALQGVVSWGVGCALKGKPGVYTKVCNYVSW
IQRTISSN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcatttggctgttagcactcttgggagcagctgttgcctttcccatcgatgat
gaagacgatgataagattgtgggcggctacacctgccaaaagcattctgtcccctatcag
gtctccctgaattccggataccatttctgtggtggctccatcataaagagccaatggatt
gtttcagctgctcactgctataaatcccgaatccaagtgagacttggggaacacagtttg
acgaaaaatgatggttctgagcagtatattgattcagtgaaagtcattcgtcatcccagc
tacaactcccaaaccttggacaatgacatcatgctcatcaaactatccaaaccagccact
ctcaattcccgtgtttcagcagtcaatctaccaaacagctgtccagccagtggagcaaaa
tgtttaatctctggatggggcaacactctcagcagtggctcaagctatccagacctccta
cagtgtctgactgcccctatactttctcagagtcaatgcagtaaggcttatccagggaaa
atcaccaacaatatgttttgtgcaggatacctggaaggtggaaaagactcttgtcaggga
gactctggtggcccagttgtctgcaatggggcactccaaggagttgtctcttggggcgtg
ggatgtgctctgaaaggcaagcctggtgtctacactaaagtttgcaactatgtttcctgg
attcagagaaccatcagttccaactga

DBGET integrated database retrieval system