KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107286956
Entry
107286956         CDS       T05763                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04012  ErbB signaling pathway
pmur04068  FoxO signaling pathway
pmur04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107286956 (CDKN1B)
   04068 FoxO signaling pathway
    107286956 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107286956 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107286956
NCBI-ProteinID: XP_029139877
LinkDB
Position
Unknown
AA seq 223 aa
MPVSRVLLPWVEVSPPPKLPRRARPSGRRSPHLASPRLAWAAPGPAESAPRSPRRPPPAR
PARGLCEARPRRAXNFDFRRGQPLEGRFEWRALDRAALPDFYSRPPRLGSARQPDGPQRR
PEPGADRSPPGVLRCAQGGEAAAPEPEPQPEPQQDGAAPARGSAGPRKRPAAEDSSPQSK
RANTAEEISEDPPEDPLVASSEEQTPKKKKKKQQQPGPKRCQT
NT seq 672 nt   +upstreamnt  +downstreamnt
atgcccgtttcaagagttctgcttccttgggtagaggtctcgccgccgccgaagcttccc
cgccgggctcggccgtccggccggcgctcgcctcacctcgcctcgcctcgcctcgcctgg
gcggcccccggacctgccgagagcgctcctcggtcgccccgccgcccgccgcccgcccgc
cccgcgcgcggcttatgcgaggcccggcctcgcagggctnggaacttcgactttcggcgc
gggcagcccctggagggccgcttcgagtggcgggcgctggaccgggcggcgctgcccgac
ttctacagccgcccgccgcggctcggctcggcccggcagcccgacggaccccagcgccgc
ccggagcccggcgccgaccgctcgccgcccggggtgcttcgctgcgcgcagggaggagag
gcggcggcgccggagccggagccccagccggagccccagcaggacggggccgcgccggcc
cgaggaagcgccggccccaggaagcgccctgccgccgaggattcctctcctcaaagcaaa
agagccaacacagctgaagaaatttctgaagatcctccagaagacccgctggtggccagc
tccgaggaacagacaccgaagaagaagaagaagaagcagcagcagcccggtccgaagcgg
tgccagacgtaa

DBGET integrated database retrieval system