KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107286957Help
Entry
107286957         CDS       T05763                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00010  Glycolysis / Gluconeogenesis
pmur00053  Ascorbate and aldarate metabolism
pmur00071  Fatty acid degradation
pmur00280  Valine, leucine and isoleucine degradation
pmur00310  Lysine degradation
pmur00330  Arginine and proline metabolism
pmur00340  Histidine metabolism
pmur00380  Tryptophan metabolism
pmur00410  beta-Alanine metabolism
pmur00561  Glycerolipid metabolism
pmur00620  Pyruvate metabolism
pmur01100  Metabolic pathways
Module
pmur_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107286957 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    107286957 (ALDH2)
   00620 Pyruvate metabolism
    107286957 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107286957 (ALDH2)
   00561 Glycerolipid metabolism
    107286957 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107286957 (ALDH2)
   00310 Lysine degradation
    107286957 (ALDH2)
   00330 Arginine and proline metabolism
    107286957 (ALDH2)
   00340 Histidine metabolism
    107286957 (ALDH2)
   00380 Tryptophan metabolism
    107286957 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107286957 (ALDH2)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107286957 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107286957
NCBI-ProteinID: XP_015670888
LinkDB All DBs
Position
Unknown
AA seq 524 aa AA seqDB search
MLRLALAPRSPARLRPGALLRLACRPLATAALPAPNPQPEIAYTKIFINNEWQDAVSKKT
FPTVNPSTGEVICQVAEGDKADVDKAVKAAKEAFKFGSPWRRMDASQRGRLLNRLADLIE
RDRTYLAALETLDNGKPYAISYLVDLDMVIKKFRYYAGWADKLHGKTIPLDGDFFTYTRH
EPVGVCGQIIPWNFPLLMQSWKLGPALATGNVVVMKLAEQTPLTGLYVASLIKEAGFPPG
VVNIIPGYGPTAGAAISSHMEVDKVAFTGSTSVGHLIQKAAADSNMKRVTLELGGKSPNI
IMSDAEMDWAVEQSHSALFFNQGQCCCAGSRTFVQEDIYHEFVERSVERAKSRVVGNPFD
FQTEQGPQVDETQYKKILGYIDSGKKEGAKLLCGGSPAADKGYFIQPTIFGDVQDNMKIA
REEIFGPVMQIFKFKTIEEVIQRANETKYGLAAAVFTKDIDKANYISQGLRAGTVWINCY
NVFGAQAPFGGFKESGQGREGGEYGLNSYMEIKTVTIKVPQKNS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcctggccctggccccgcggagccctgcccgactgcgccccggggcgctgctc
cgcctggcctgccggcccctggccaccgccgccctgcccgcgcccaacccgcagccggag
atcgcctacaccaagattttcatcaacaacgagtggcaggatgcggtcagcaagaaaacc
ttccccaccgtcaacccatccacaggggaggtcatctgccaggttgcggagggcgacaag
gccgatgtggacaaggcagtcaaggcagccaaagaggccttcaagtttgggtctccttgg
agaaggatggacgcctctcagaggggcaggctgctgaaccgactggctgacctgattgaa
agagaccggacctatttggccgctttggaaacgttggacaatggcaagccatacgcaatc
tcctacctggtagacttagacatggttatcaagaaattccggtattatgcaggctgggct
gacaagttgcacgggaaaaccattcccctggatggagattttttcacttacacaagacat
gagcctgtgggcgtttgtggacagatcattccgtggaacttcccgttgctgatgcagtcg
tggaagctcggtcccgctctggccacagggaacgtggtggtgatgaaactggccgaacag
actcccttgactggcttgtacgttgccagcctgatcaaagaggctggattcccaccaggc
gtggtgaacattattcctggttatggccctacggctggggctgctatatcttctcacatg
gaagtggataaagttgcattcactggttccacctcggttgggcacctgatccagaaggct
gcagcagacagtaatatgaagagagtgactctggagcttggtgggaagagcccaaatatt
atcatgtctgatgctgaaatggactgggctgttgaacaatctcattctgcgctgttcttc
aatcaaggccagtgctgttgtgctggatctcggacctttgtccaagaagatatatatcac
gagtttgtggaaaggagtgtggagagagccaaatccagagtagttggaaacccatttgac
ttccaaactgaacaggggcctcaggtggatgaaacacaatataagaagatccttggatac
attgacagtggaaaaaaggagggagcaaaattactttgtggtgggagccccgcagcagat
aagggctactttatccagccaactatctttggagatgtgcaggacaatatgaaaatagcc
agagaagagatttttgggcctgttatgcagatcttcaaattcaaaaccattgaggaagtc
atccagagggcaaacgaaaccaaatacgggctggcagccgctgttttcacaaaagatatc
gataaagccaactacatttctcagggtttgcgagctggaactgtttggattaattgctac
aatgtgtttggggcacaggctccatttggagggttcaaagaatctggccaagggcgtgag
gggggagaatatggcctgaactcatacatggaaataaaaacagtcaccatcaaagtccca
caaaagaattcttga

DBGET integrated database retrieval system