KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107287054
Entry
107287054         CDS       T05763                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04012  ErbB signaling pathway
pmur04068  FoxO signaling pathway
pmur04110  Cell cycle
pmur04115  p53 signaling pathway
pmur04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107287054 (CDKN1A)
   04068 FoxO signaling pathway
    107287054 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107287054 (CDKN1A)
   04115 p53 signaling pathway
    107287054 (CDKN1A)
   04218 Cellular senescence
    107287054 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107287054
NCBI-ProteinID: XP_015670995
LinkDB
Position
Unknown
AA seq 149 aa
MPLSESKILQPSCSRKLCRNLFGPVDHEQVQKDFQSLMKVQLEEAQQKWNFDFETETPLE
GNYKWEKVSHLNMLPSPDLLGHTKENSCTGEKSRSSPALFKRHTKTERQVQMGLEACKAD
SPRCLKRKQTSIKDFYGSKRRTIPYKSKP
NT seq 450 nt   +upstreamnt  +downstreamnt
atgcctctttctgagagtaaaatccttcaaccttcctgcagcaggaaactatgcagaaat
ctctttggaccagttgatcatgagcaggtccagaaggactttcagtccttgatgaaggtc
cagctggaggaagcccaacaaaagtggaactttgactttgaaacagaaacccctctggaa
gggaattacaaatgggagaaggtctctcatctaaatatgctgccatctccagatctcttg
ggccatacaaaggagaacagctgtacaggggaaaagagccggagttcaccagcactcttc
aagaggcacacaaagacagagagacaagtgcagatgggccttgaagcttgtaaggctgac
tcccccagatgtttgaaaagaaagcagacaagtatcaaagacttttatggttcaaagcga
agaactatcccttataagtcaaagccatga

DBGET integrated database retrieval system