KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107288329
Entry
107288329         CDS       T05763                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04010  MAPK signaling pathway
pmur04020  Calcium signaling pathway
pmur04260  Cardiac muscle contraction
pmur04261  Adrenergic signaling in cardiomyocytes
pmur04270  Vascular smooth muscle contraction
pmur04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107288329 (CACNA1C)
   04020 Calcium signaling pathway
    107288329 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107288329 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107288329 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    107288329 (CACNA1C)
   04270 Vascular smooth muscle contraction
    107288329 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pmur04040]
    107288329 (CACNA1C)
Ion channels [BR:pmur04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107288329 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel
Other DBs
NCBI-GeneID: 107288329
NCBI-ProteinID: XP_015672425
LinkDB
Position
Unknown
AA seq 1867 aa
MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYLTGIATDTPAEEEPAPCAPISQHGR
QCQNGSECRAIWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVY
FVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQA
EDIDPENEDEGMDEEKPRNMSMPTSETESVNTDNVAGGDIEGENCGARLAHRISKSKFSR
YWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLAIASEHYNQPDWLTEVQDTANKVLL
ALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRL
LRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQT
RRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYIL
LNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKHEPEKPAMEAETKEEKI
ELKSITADGESPPSNKSNTDEYQPNENEEKNPYPTAETPGEEDEEEPEMPVGPRPRPMSE
LHLKEKAVPMPEASAFFVFSPSNKFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVR
HYSVRNQILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF
GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFA
CIGVQLFKGKLYSCTDSSKQTEAECKGNFITYKDGEVSQPIILSRNWENSKFDFDNVLAA
MMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGF
VIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYL
MFVLILLNTICLAMQHYGQSILFKQAMNILNMLFTGLFTVEMVLKLIAFKPKHYFCDAWN
TFDALIVVGSIVDIAITEVTVSSWHLGSNTEDNSRISITFFRLFRVMRLVKLLSRGEGIR
TLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTDINRNNNFQTFPQAVL
LLFRCATGEAWQEIMLACLPDKKCDNDSVEPNSNTEGEHPCGSSFAVFYFISFYMLCAFL
IINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQP
PLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELR
AIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQR
NALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNH
VSYYQSDGRSSFPQTFTTQRPLHINKSSNNQGDTESPSHEKLVDSTFTPSSYSSSGSNAN
INNANNTALSRFYNPPSYPNTVSTVDSYSTPSSTTVRIQEVPWKFSCRRSYSRDSQVAIV
SEEEAPQEDETYSEQLNEETEYCSEPNLLSPEMLSYQDDEHRQLTLPKSKEDVQPSPKIG
FLHSSSLNRRASFHLECLKRQKNQTAGVSQKITLPLHLLHRQALSVGGQSPLQSSHSSIR
SSRPCSTSSATHCTQDWPQQHDKGLWPDEEASNEKLNNSFPSIYCSSSYCDSTSSSSTRK
ARPVSLIVSSQTRESGRQFHGSANSLVEAVLISEGLMQFAQDPKFIEVTTQELADACDLT
IEEMENAADNILNGNSKPSPNGNLLPFVNCRDPGQDCMGEEAEAAQNPDCRKSQEESKDT
RIYISSL
NT seq 5604 nt   +upstreamnt  +downstreamnt
atggtcccattgctgcacattgccctgctggtgctgtttgtcataattatctatgccatc
attgggttggagctcttcatgggaaagatgcacaaaacctgctacttaacagggattgcc
acagatacacctgcagaagaagaaccagctccctgtgctcctatatctcaacatggacgg
cagtgtcagaatggctctgagtgtagggccatatgggagggacccaaacatggcattacc
aactttgacaactttgcctttgccatgttaactgtgtttcagtgcatcaccatggagggc
tggacagatgtactctactggatgcaggacgctatgggctatgagttaccctgggtgtac
tttgtcagtctggtcatctttggatcctttttcgttcttaatctggttcttggtgtgttg
agcggggagttttctaaagagagagaaaaggcaaaagctcgaggtgactttcagaagcta
agagagaaacaacaactggaggaggacttaaaaggatatctagactggataactcaggca
gaagatatcgatccagaaaacgaggatgaaggcatggatgaggagaagccccgaaacatg
agcatgcccaccagtgagacagaatctgttaacaccgacaatgtggctggaggcgatatt
gaaggagaaaactgtggtgcacgactggcgcaccggatttctaaatctaagtttagccgc
tactggcgtagatggaatcgattctgtagacgaaaatgccgagctgctgtcaaatccaat
gtgttctactggcttgtgatcttcctggtgtttctcaacacactggccattgcctctgaa
cattacaaccaacctgattggctcactgaagtccaagacactgcgaataaggtattgctg
gctttgttcacggctgagatgctgctgaagatgtacagcctgggtcttcaagcttacttt
gtgtccctcttcaaccgctttgattgtttcatcgtgtgtggtggaattctggaaaccatc
ttagtggaaacaaaaatcatgtccccacttggcatctccgtgctgagatgtgtacgactt
ctgagaatctttaaaatcacaaggtactggaattccttgagtaatttggtggcttccttg
ctcaactcagtgcgctccattgcctccctgctgctgctcctcttcctcttcatcatcatc
ttctccctcctaggaatgcagctctttgggggcaagtttaactttgatgagatgcagacc
aggagaagcacctttgacaactttccacagtctttgctcactgtgtttcagatcctgact
ggggaggactggaattcagtgatgtatgatggaatcatggcttatggcggcccctctttt
ccaggaatgttggtctgtatttacttcatcatcctcttcatctgtggaaactatatcttg
ctgaatgtcttcttggccattgctgttgacaatcttgctgatgctgaaagcctaacatct
gctcaaaaggaggaggaagaggaaaaagaaaggaaaaaactagcaaggactgccagtcct
gagaagaaacacgagcccgagaagccagctatggaggcagagacaaaggaggaaaaaatt
gagctgaaatcaattacagctgatggagaatctccaccttctaataagagcaacacagat
gaatatcagccgaatgaaaatgaagaaaaaaatccctatcctactgcagagacaccagga
gaggaggacgaagaagaaccggagatgcctgttgggcctcgtcctcgccctatgtctgaa
ctgcaccttaaggagaaagcagtgccaatgccggaagccagtgcttttttcgttttcagt
cccagcaacaaatttcgggtccactgccatcgcatcgttaataataacattttcaccaac
ctgatcctctttttcatcttgctcagcagcatctctttggcagctgaggacccagttcgg
cattactcagttagaaatcaaatcctaggcaatgcagattatgtcttcactagtatcttt
acattagaaattattcttaagatgactgcttatggggctttccttcacaaaggctccttc
tgcaggaactacttcaacatcctggacctgctagtggttagcgtttctctcatctccttc
gggatccagtccagcgcaatcaatgtagtaaagatattacgtgttttgagagtcctcaga
ccgttgcgggcaatcaacagagcaaagggtttaaagcatgtggttcaatgcgtatttgta
gctatacgaaccatagggaatattgtgatcgtgaccactttgttgcagttcatgtttgcc
tgcattggagttcagttgttcaagggcaaactgtacagctgcactgatagctccaaacaa
acagaagcagaatgcaagggcaattttatcacttacaaggatggagaggtgtctcaacca
attattctgtcccgaaactgggagaatagcaaatttgattttgacaatgtcctcgccgct
atgatggcccttttcactgtttcaacctttgaaggctggccagaactgctgtatcgatct
attgattcccatatggaagatgtggggcccatctataaccacagggtggagatctcaatt
ttcttcattatttatatcatcatcattgctttcttcatgatgaacatctttgttggtttc
gtcattgtcacgtttcaagagcaaggagaacaggaatataagaactgtgagcttgacaag
aaccagcgtcaatgtgtagaatatgctctgaaggcccggcccctgcgaagatatatcccc
aaaaaccagtaccaatataaagtgtggtatgtggtgaactccacctattttgaatacctg
atgttcgtcctcatcttgctgaacaccatctgcctggccatgcaacactatggtcaaagt
atcctcttcaaacaagcaatgaacatcctcaacatgctgttcactggccttttcaccgtt
gagatggttctgaagttaattgccttcaaacccaagcactatttctgtgatgcatggaat
acatttgacgccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtgacc
gtaagtagctggcacttaggcagtaacacagaggacaactctcgcatctcaatcaccttt
ttccgactcttccgtgtgatgcgtctggtgaagctcttgagtcgaggggagggcatccgc
acgctgctttggaccttcatcaagtctttccaggctctcccctatgtggctctattaata
gtgatgctgttttttatctacgctgtgattgggatgcaggtgtttggtaaaattgcatta
aatgatactacagacatcaatcggaacaacaactttcaaacatttcctcaggctgtactc
ctgcttttcagatgtgctactggtgaagcttggcaggaaatcatgctggcatgcctacct
gataagaagtgtgacaatgactctgtggaaccaaacagtaatactgaaggtgaacatccc
tgcgggagcagctttgctgtattttatttcatcagtttctacatgctttgtgcctttcta
atcattaacctttttgttgctgttattatggataattttgattacctaacccgtgattgg
tccattctgggtccccatcatctggatgagtttaaacggatttgggcagagtatgatcct
gaagccaaaggacgtatcaaacacctagatgttgtaacactcctgcgtcggatacaacct
cccctgggttttggaaaactctgtcctcacagggtagcttgcaagcgtcttgtctctatg
aatatgccattgaatagtgatggaactgttatgtttaatgcaactttatttgcattggta
agaacagcactgagaatcaaaacagaaggtaacttggaacaagccaatgaggagctgcgt
gcaatcattaagaaaatctggaaacgcactagcatgaagctgttggatcaggttgtaccc
ccagcaggtgatgatgaagttacagttggaaaattctatgccactttcctaattcaagaa
tatttccgaaaattcaaaaaacgcaaagaacagggtctcgtgggcaaaccttcacaacgc
aatgctctttctctacaggctggtctacgcacattacatgacattggaccagagattcga
agggcaatatctggagacttgacagcagaagaggaattagacaaggccatgaaagaagct
gtttctgctgcttctgaagatgatattttcaggagagctggtggcttgtttggaaatcat
gtcagctattaccaaagtgatggcagaagctcattccctcagacattcactactcagcgc
cctttgcacatcaacaaatctagcaacaaccaaggagacactgaatccccgtcccatgag
aagcttgtcgattccaccttcactccaagtagttactcctcatcaggttccaatgctaac
atcaataatgccaataatactgccttgagccgcttttacaatccaccaagctatcccaac
accgtcagcaccgtggacagctacagcaccccttcctccaccactgtacggatccaggaa
gttccttggaagttcagttgcagaagatcctattccagagacagccaagtagcaattgtt
agtgaagaggaagctcctcaggaggatgaaacatatagtgagcaattaaatgaagaaact
gaatattgtagtgaaccaaatttgttatcacctgaaatgttatcgtaccaagatgatgaa
cacagacagctaactctcccaaaaagcaaagaagacgtccagccatctccaaagattgga
tttctacattcctcatcactaaatcgaagagcatcctttcatctggagtgtctaaagaga
cagaaaaatcagactgcgggtgtctcccagaaaataacattacctttgcatctattacat
cgtcaagcactatcagttggaggtcagagtcctcttcaaagtagtcattcatcaattaga
tcttctcgaccctgttccacatcatctgcaacacattgtacacaagactggccacagcaa
catgataaagggttgtggcctgatgaggaggcctccaatgagaaactcaataatagcttc
ccatcaatatactgcagctcctcatattgtgatagcaccagctctagcagcacccgaaaa
gccaggccagtctcccttatagtttccagtcagacaagagagagtggcaggcaattccac
ggtagtgccaacagccttgttgaagcggtcttgatttcggaaggactgatgcagtttgct
caagatccaaagttcattgaggttaccacccaagaactagctgatgcctgtgacttgaca
atagaagagatggagaatgctgcagacaacattctcaatggtaacagcaaaccaagcccc
aatggcaacctcttgccttttgttaactgcagggacccggggcaggactgtatgggtgaa
gaagcagaagcagcccaaaacccagattgtaggaaaagtcaagaggagtctaaggatacc
aggatttatatcagcagcctgtag

DBGET integrated database retrieval system