KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107288718
Entry
107288718         CDS       T05763                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Ras_bdg_2 C1_2
Other DBs
NCBI-GeneID: 107288718
NCBI-ProteinID: XP_015672844
LinkDB
Position
Unknown
AA seq 372 aa
MKRPTAQEMIELQTLGLEEQLDLTRGPRGTAERPVRLERANALRISPGKVPELLTRVRQI
RLLGGEIDPKLTEELGEGHLFRSCTQSQPTWCDLCGEFIWGVYKKRLRCIYCKFICHYRC
RALIRLDCRGPRYKNEQEEGNEQTIEKDTNVDEQIDWEKTILSQAEIEQKIKEYNSQINS
NLFMSLNKDGSYTGFIKVQLKLIRPVSVPANKKAPSIQDTRKSSVRSQAVKRRTSFYLPK
DTIKHLHIISRTRASEVIEALLKKFMVVDNPRKFALFERTEKDDQVYIRKLSDEEQPLRL
RLLAGPNEKTLSFVLKENETGDVNWDAFSMPELQNFLRILKREEEEHTRQILQKYAHCRQ
KMQEALAARTPG
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgaagcgtcccacggcccaagagatgatcgagctccagaccctggggctggaggagcag
ctggacctgacgcgcggcccgcggggcacggccgaacgccccgtccgcctagagcgcgcc
aacgccttgaggatctctcccgggaaagtgcccgagctcttgacccgcgttcgccagatc
cgccttctgggtggcgagatcgatcccaaactgaccgaggaactcggcgagggacacctc
ttcagatcctgcactcagagtcagcccacctggtgcgatctgtgcggggagttcatctgg
ggcgtctacaaaaagcgtctccgttgcatctattgcaagttcatctgtcattaccgatgc
cgtgctctaatccgacttgattgcaggggtcccagatataaaaatgagcaggaagaaggc
aatgagcagacaatagaaaaagacactaatgtggatgaacagattgactgggagaaaacc
attttgtcccaagctgagattgaacaaaagataaaagaatataatagccagataaacagt
aacctctttatgagtttgaataaagatgggtcctatactggcttcattaaggtacaacta
aaactgatccggcctgtgtcagtacctgccaataagaaagcaccctcaatccaggacact
aggaagagttctgtgcgcagccaggctgtaaagcgccgaacttcattctacttaccaaag
gatacaatcaagcatctgcatataatttctcgtacacgggccagtgaagtcattgaagcc
ctgctcaagaaattcatggttgttgacaatccccgcaaatttgccctctttgagagaaca
gaaaaagatgaccaagtatatatccgtaagctttctgatgaggagcaacccctgcgtctc
cgactacttgctggtcctaatgaaaaaacactcagttttgttctgaaggaaaatgagact
ggtgacgttaattgggatgcctttagcatgcctgaattgcagaattttcttcgtatcctg
aagcgtgaagaagaggagcatactcggcagattctgcagaaatatgcccattgtcgccaa
aaaatgcaagaggctttagctgctcgcaccccaggttga

DBGET integrated database retrieval system