KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107289094
Entry
107289094         CDS       T05763                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107289094 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pmur04030]
    107289094 (PTGDR)
G protein-coupled receptors [BR:pmur04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    107289094 (PTGDR)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 107289094
NCBI-ProteinID: XP_029140307
LinkDB
Position
Unknown
AA seq 361 aa
MATGDYRCNRTLRLEAGQSVLPGSLLFAAGLLGNVLALGLLWQHHLKAKLQRGQGRPRAS
AFYLLVSTLAATDLLGKCLLSPIVLAAYAHNRSLIDLHPGEEASRSPGTLCQLFAFLMAF
FGLASTTLLLAMALECWLSLGQPYFYERHTSRRWGALFTGTAAVLCALFCALPFLGFGSN
VQYCPGTWCFIRMAGGGWLYSVLYATLLGLLVLAVGLCNLGSMRSLYRMARRQPPRRTHL
IDPQGAAAPARLPSSGRTEELGQLVLLALMTALFTICSLPLIIRAYIGAFAPDANEAADL
TALRFFSVNSIVDPWVFIIFRTSIFRSLLQRFSRRLSLKKDLHFQDQLLGTWQRKESNDI
R
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggccacaggcgactaccggtgcaaccggaccctgaggctcgaagcaggccagtcggtg
ctgcccggctcgttactcttcgcggcggggctgctgggcaacgtgttggcgttggggctg
ctgtggcagcaccatctgaaggcgaagttgcagcgcggccaggggcgcccgcgggcgtcc
gccttctaccttctggtgagcaccctggccgccaccgacctgctgggcaagtgtctgctg
agcccgatcgtgctggccgcctatgctcacaatcgcagcctcatcgacctccaccccggg
gaggaagcgagccgctcccccggcacgctgtgtcagctgttcgcgttcctcatggctttc
ttcggcttggcgtccaccacgctgctgctggccatggccctggagtgctggctctcgctc
ggccagccttacttctacgaacgccacaccagccggcgttggggcgcgctgttcaccggc
acggcggccgtcctctgcgcgctcttctgcgccctgcccttcctgggcttcggcagcaac
gttcagtactgtccgggcacgtggtgcttcattcgcatggccggcggcggatggctctat
tcggtgctctacgcgaccctgctgggcttgctggtgctggccgtgggcctgtgcaatctg
ggcagcatgaggagcctctatcggatggcgcgtcggcagcccccgcgcaggacccacctg
attgaccctcagggcgcagccgcccctgccaggctcccttcctccgggcgcaccgaggag
ctgggccagttggtcctgctggcgctcatgaccgcccttttcaccatctgctccctgccg
ctgatcatccgagcttacattggagcctttgcccctgatgccaatgaggcagctgatctt
acagccctccgttttttctctgtcaactccattgtggatccctgggtcttcatcattttt
cggacatccatatttcgcagtttgctccagcggttttctaggaggctgagtttgaagaag
gatctgcatttccaggatcagctcttgggaacttggcagaggaaagaatccaatgacata
cgataa

DBGET integrated database retrieval system