KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107289374Help
Entry
107289374         CDS       T05763                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00020  Citrate cycle (TCA cycle)
pmur00190  Oxidative phosphorylation
pmur01100  Metabolic pathways
pmur01200  Carbon metabolism
Module
pmur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pmur_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107289374 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107289374 (SDHA)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107289374 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 107289374
NCBI-ProteinID: XP_029140349
LinkDB All DBs
Position
Unknown
AA seq 660 aa AA seqDB search
MALTLGRLRYLQLFCKQRPAAYDLFSRNFHFTAYGKKNVSAKISDPISTQYPVVDHEFDA
IVVGAGGAGLRAAFGLSEAGFNTACVSKLFPTRSHTVAAQGGINAALGNMEVDNWRWHFY
DTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTDDGKIYQRAFGGQSLKFGKGG
QAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECCGVIALCIEDGTI
HRFRAKNTVIATGGYGRTYFSCTSAHTCTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAG
CLITEGCRGEGGILINNEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPDKDHV
YLQLHHLPPQQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVIIR
ENGKDQIVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIAELCKPGESIPSI
KSNAGEESVANLDKLRFANGRVRTSELRLSMQKTMQSHAAVFRTGPVLQEGCEKMSKLYK
DFDDLKTFDRGVVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEY
DYSKPISGQQKKPFEQHWRKHTLSYVDVKIGKVTLDYRPVIDKTLNEEDCATVPPAIRSY
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgactttgggaaggctgagatatttgcagctgttctgcaagcaaaggccagca
gcttatgatctgttttctcgtaattttcacttcactgcatatggaaagaagaatgtgtct
gccaaaatatctgatccaatttcaacacagtatcctgtagtggaccatgaatttgatgca
attgtagtgggtgcaggtggtgcaggtttgagagctgcatttggcttgtctgaggctggg
tttaatacagcgtgtgtttccaaattattcccgaccagatctcatactgttgctgcacaa
ggaggaatcaatgctgctttggggaacatggaagttgataactggcgatggcatttctat
gatactgtgaaaggctctgactggctaggagatcaggatgcaattcattatatgacagag
caagcccctgcttcagttattgagctagagaattatggtatgccatttagcaggacagat
gatggaaagatctatcaacgtgcttttggaggtcagagccttaaatttgggaaaggagga
caggctcaccgttgctgttgtgtggctgataggacaggtcactctctgttacatacactg
tatggccggtcactcagatatgataccagctactttgtggaatattttgctcttgatctt
ctaatggaaaatggagaatgttgtggtgttattgcactttgcatagaagatggcacaata
catcgttttagagcaaagaatacagttattgccaccggaggatatgggcgcacatatttt
agctgtacttctgctcacacttgtactggagatggcacagcaatggttacacgggcaggc
ctaccttgccaggatttggaatttgtgcaattccatcccacaggtatttatggtgctggc
tgtcttattacagaaggctgtcgtggtgaaggaggtattttaattaacaatgaaggagaa
agatttatggagagatatgctccagttgccaaagatctagcttcccgagatgttgtatct
cgttctatgactattgagatccgtgaaggaagaggttgtggaccagacaaagatcacgtg
tacttgcagttgcaccatttgccaccacagcagctagcaatgcgtcttcctgggatttca
gaaactgctatgatatttgctggtgtggatgtcacaaaagagcctattcctgtcctacct
actgtgcattacaatatgggaggtatccctacaaactacaaaggacaggtaattatacgt
gaaaatggcaaagatcaaatagtacctggtttatatgcttgtggtgaagcagcttctgca
tctgttcatggtgctaatcgacttggtgcaaactcgcttttggacttggtagtctttggt
cgtgcctgtgctcttaccattgcagaattatgcaaacctggggaatcaattccatcaatc
aaatcaaatgcaggtgaagaatctgttgcaaaccttgacaaattgcgctttgccaatgga
agagtgagaacatcagaattgagacttagtatgcaaaaaacaatgcaaagccatgctgct
gtgttccgtacaggccctgtcttacaagaaggctgtgaaaaaatgtccaaactctataaa
gattttgatgatctgaaaacatttgatagaggtgttgtttggaatactgatttggtagag
actttggagctacaaaatctcatgctgtgtgctttacaaactatttatggagcagaagct
cgaaaagagtcacgtggagctcatgctagggaggactataaggttaggatagatgaatat
gattattctaaaccaatctcaggacagcagaagaaaccatttgagcagcattggagaaaa
cacacactctcttatgtagatgtgaagattggaaaggttacactggattatagacctgta
atagataaaaccctgaatgaagaagattgtgctacagttccaccagctatccgctcgtat
taa

DBGET integrated database retrieval system