KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107290268
Entry
107290268         CDS       T05763                                 

Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04010  MAPK signaling pathway
pmur04060  Cytokine-cytokine receptor interaction
pmur04068  FoxO signaling pathway
pmur04144  Endocytosis
pmur04218  Cellular senescence
pmur04350  TGF-beta signaling pathway
pmur04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107290268
   04350 TGF-beta signaling pathway
    107290268
   04068 FoxO signaling pathway
    107290268
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107290268
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107290268
  09143 Cell growth and death
   04218 Cellular senescence
    107290268
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107290268
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmur01001]
    107290268
Enzymes [BR:pmur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107290268
Protein kinases [BR:pmur01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107290268
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal TNFR_16_TM Choline_kinase
Other DBs
NCBI-GeneID: 107290268
NCBI-ProteinID: XP_015674619
LinkDB
Position
Unknown
AA seq 583 aa
MNRVALQNWDLITGKIQKMGYWRRLPQLLLLLLQLPCNSRAGRNVNSNVCKWCDNTYPIC
ENQVCYSNCDFSSYCEKPEEICVSLWKQVNASIKVNTFCHNPQLPVENVMISKYNTSQCI
MARQQNEDGVFYICGCVKEQECNDKLIFENHTNGYSMLHSREIIPVAAISLLPPLLVAIM
ITVIFYLCRTHRQRRRSKEWAQKHSRCRELPESRRATTYDEILSVKIDHHSALHPACASS
LNYINELLPVELDERVGKGQFAEVWKAKLKHASSGKYEMVAVKIFPCEEFASWKNESQIF
ADANLKHCSILRFLSAEERHSGLQKEYWLITAYHSQGNLKDYLSRNILSWRNLQKMAGSL
VSGVAYLHSDYTPGGSPKIPIAHRDIKSTNVLIKNQQECVLCDFGIALRLDPSLSVEDFA
NSGQVGTARYMAPEVLESRVNLEDLESFKQMDVYSMALVLWEIASRCDAIGEVKNYEPPF
GSKVRERPCMEVMRDIVLYGRERPEIPTNWLVHQGMHFLCDTITECWDHDPEARLTAHCV
AERFNLMEQTDCDDILNNNSIDNEANKMGCSRDENQNNDRNIQ
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgaaccgagtagcactgcaaaactgggatttgattactggcaagatccagaaaatgggt
tactggaggaggcttcctcagcttctgctgctgctgcttcagctcccatgcaacagccga
gcaggaaggaatgtgaatagcaatgtctgcaagtggtgtgacaatacatatcccatctgt
gaaaatcaggtgtgctacagcaactgtgattttagctcctattgtgaaaaaccagaagaa
atctgtgtttctctatggaaacaagtcaatgccagtataaaagtgaacactttctgccac
aacccgcaactgccagtggaaaatgtcatgatatcgaagtataacacatcacagtgcatc
atggcccggcagcagaatgaggatggcgttttttacatctgtggttgtgtgaaagagcag
gaatgcaatgacaagcttatctttgaaaatcataccaatggatactccatgctccatagc
agggaaatcattcctgtagcagccatcagcctgctgcccccgctgttggtggctatcatg
atcaccgtgatattctacctctgccgaacccatcggcagaggagacgatccaaggagtgg
gcccagaaacattctcggtgccgtgagctacctgaatcccgcagagccaccacttatgat
gagatcctgtctgtcaagatagatcatcattctgctctccacccggcctgtgccagtagc
ctcaactacatcaacgaactcctgccagttgagttggacgaaagagtggggaaagggcaa
tttgcagaagtctggaaagccaaactgaagcatgcatcttcaggcaagtatgagatggtg
gctgtgaagattttcccttgtgaggaatttgcatcctggaaaaatgaaagccagatcttc
gcggatgccaacctgaagcactgcagcatccttcggttcctttctgcagaggagagacac
tctggacttcagaaagaatactggctgatcaccgcctatcacagccaaggcaatcttaag
gattacctgtccaggaatattctcagctggagaaacttgcaaaagatggcaggttccctc
gtgagtggcgtggcctacttgcacagtgattacactcctggcggcagccccaaaattccc
attgcccaccgcgatatcaaaagcacaaatgttctcattaagaaccaacaagaatgtgtg
ctgtgtgatttcggaattgctctgagactggatccatctttaagcgtggaagattttgcg
aatagtggacaggtgggtactgccagatacatggctcctgaggttttggaatccagagtg
aatcttgaagatctggaatcctttaagcaaatggatgtctattctatggctctggtttta
tgggagatagcctccaggtgtgatgctataggagaggtgaagaactatgaaccacccttt
ggatcaaaggttcgagagcgaccttgcatggaagttatgagagacattgtgctgtatggt
cgagaacgtccagagataccaactaactggttggtgcatcagggaatgcattttctgtgt
gacaccatcacagaatgctgggatcatgaccctgaagctagacttacagcccactgtgtt
gcagagcgattcaacttgatggagcaaacagattgtgatgacattctcaacaacaacagc
atcgacaacgaagcaaacaaaatgggttgttcaagagacgagaaccaaaataatgacagg
aacatccaatga

DBGET integrated database retrieval system