KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107290543Help
Entry
107290543         CDS       T05763                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107290543 (SOD1)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107290543 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 107290543
NCBI-ProteinID: XP_015674917
LinkDB All DBs
Position
Unknown
AA seq 163 aa AA seqDB search
MAKDMASRKAVCILLRDPACKANVNGIIYFDQRDDGNVIVKGRIEGLTPGKHGFHVHEFG
DNTTGCTSAGPHFNPEGKTHGGPQDEIRHVGDLGNVVANESGVAEVLMEDHLISLSGPHS
IIGRSMVVHEKEDDLGKGQNEESLKTGNAGARLACGVVGLAKA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagacatggcgtcgcggaaagcggtttgcattctccttcgcgatcccgcctgc
aaggccaacgtcaacggcattatttactttgaccagagagatgatggaaatgtaattgtt
aaaggaagaattgaaggattgactccagggaaacatggtttccacgtccatgaatttgga
gataacacaactggatgtaccagtgcaggtcctcacttcaatcctgaggggaaaactcac
ggtgggccacaggatgaaataaggcatgttggtgatcttggaaatgtggttgcaaatgag
tcaggtgttgcagaggtgttaatggaggatcatcttatttccctctcaggaccacattca
attattggacgttctatggtggttcatgaaaaagaggatgatctgggtaaaggacaaaat
gaagagagcttgaaaactggaaatgctggtgcccgtctagcttgtggggtggttggacta
gctaaagcataa

DBGET integrated database retrieval system