KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107291001Help
Entry
107291001         CDS       T05763                                 

Gene name
STAT6
Definition
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  signal transducer and activator of transcription 6
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107291001 (STAT6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmur03000]
    107291001 (STAT6)
Transcription factors [BR:pmur03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    107291001 (STAT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_bind STAT_int STAT_alpha SH2
Motif
Other DBs
NCBI-GeneID: 107291001
NCBI-ProteinID: XP_015675436
LinkDB All DBs
Position
Unknown
AA seq 807 aa AA seqDB search
MTNTNTSLWSYVSTMSPERFNGLYEEFPHTLRCLLGEWLETEPWEFINRSDSFCTLLAGR
LLSAMVEKIRDLANKNCNSAAQILQFVANIESRYRKDPLQLANVIKRILEAEQTAVQQQH
QHVPLVIERQREELMFRFSLEKLHYRLQEIQTLRESFQQMKGNARAPLSQNSLDCQFPIQ
DNLPASSLQSLQGLFMKMDSELEEAKKKILVRLLIWKRQQQLAGNGSPFDEDLSPLQKRL
ECLVDIWFQFRQQLITSGIELQSRVREHLDDTFKSLIQNSFLVEKQPPQVLKTQTKFQAS
VRFLLGPHLLKHPPTSFLVTADIVTEKQARELTANHSPSVFSESTGEIVNNTASLDINAS
SNSCTSQFKNLLLKKIKRCDRKSTESVTEEKCAVLFSANICLGPNQTNFHLQALSLPVVV
IVHGNQDNNAKATILWDNAFAAPDRVPFVVAERVSWKAMCDTLNQKFLAEVQTTKGLLKD
HYFFLAQKIFGDNITSLEELQRCHVSWSQFNKEMLPGRGFTFWQWFEGILDLTKKYLKNY
WSDRLIMGFVSKQYVFNYLSNAPAGTFLLRFSDSEIGGISIAYVNYFPDGSTQVENIQPF
TAKQLSIRSLADCVLDLPQLHVLYPNRPKHEAFRRDYNTETRKNTSSYVPARLTITVDTP
CSFPTSIQKPLDPLGGSNVNLAVHSDSTYHDSPVIVPSSIGTSVASSTTYGSSQLPFELM
TCSYPLGNASPLGSVDSYPMCQDVEMPDLSIPTENTVTYPGNLPLHLMADPLSVPETISP
PSSEEFEKLLHPDQDLHPDLHFCHNPV
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataccaacacgtccctgtggagctatgtctccaccatgtctccggagcggttc
aacggcttatatgaagaatttcctcatactctacgttgtctcctaggggagtggctggaa
actgaaccatgggaattcatcaacagatcagactctttctgtactcttctggctggaagg
ctgctgtctgccatggtggagaagatacgagatcttgccaacaaaaactgcaattctgct
gctcagattcttcagtttgttgctaacattgagagcagatatcggaaagatccactgcaa
ctggcaaatgttataaaaaggatcttggaagcagaacaaacagcagttcagcagcagcat
caacacgttccccttgtaatcgaacgtcagcgagaagaactgatgtttcgattcagccta
gagaagctgcactacagacttcaggagattcaaactctccgggaaagcttccagcagatg
aagggcaacgccagagctccactgtcacaaaactcactggattgtcaatttccaatacaa
gacaacctgccagcaagttctcttcagagccttcaaggactgtttatgaagatggacagt
gagctagaagaggccaagaagaagattctggtgaggcttctgatttggaagagacagcag
caactggctgggaatggaagtccatttgatgaggacttgtccccgctgcaaaagaggttg
gaatgtctagtagatatttggttccagtttcgccagcagttgatcacatctggaattgag
cttcaatctcgtgttcgagaacatcttgatgacacattcaaatctcttatacaaaattcc
ttcttggtggaaaaacagcctccacaagttttaaagacacagaccaaatttcaagccagc
gtccgcttcttgctgggacctcatttactcaagcatccgccaacatcatttctggtcacg
gctgacattgtgacggaaaaacaggcccgagaactgactgccaatcattctccctctgtc
tttagtgaaagcactggagagattgtaaacaacacagcatcgctggatataaatgcctcc
agcaattcttgtacctctcagttcaaaaatttgcttctcaaaaagatcaagcgctgtgac
cgcaagagcacagaatctgtaacggaagagaagtgtgctgtcctcttcagtgccaacatt
tgccttgggcccaaccaaaccaacttccacctacaggctctgtcgctgcccgttgtggtg
attgtccatggaaatcaggacaacaatgccaaagccaccatcttatgggacaatgctttt
gctgctcctgatcgcgttccctttgtggtggctgagcgtgttagctggaaggcaatgtgt
gacactctcaaccagaagttccttgctgaggtgcaaactacaaaaggtctactcaaggat
cattatttcttcttggcccagaagatctttggtgacaacatcaccagtctagaggaactg
cagagatgccatgtgtcctggtcccaattcaataaggagatgcttcctggtagaggattc
acattttggcaatggtttgaaggcattcttgacctcaccaagaaatacctgaagaactat
tggtctgacagactgatcatgggctttgtcagcaagcaatatgtcttcaattacctgagc
aatgcaccagctggaactttcctcttacgtttcagtgactctgagatcgggggcatcagc
atcgcctatgttaactacttcccagatggttccactcaggtggagaacatccagccattc
acggcaaagcaactgtccattcgttcactggctgactgtgttctggatctcccacagctc
catgtgctttatcctaacaggcccaaacacgaggctttcaggagggactacaacacagag
acacgaaaaaacaccagcagttatgtcccagccaggttaacgataactgtagacacaccc
tgctcattccctacatcaattcagaaaccacttgaccctctgggcggttctaatgtgaat
cttgcagtccattctgattcaacctatcatgattcgccagtcatcgttccatcatccatt
gggacatctgtagccagcagcacaacatacggaagctcacagctgccatttgaattaatg
acttgctcataccctttgggcaatgcttcccctcttggttcagtggattcataccccatg
tgccaggatgtagagatgccagacctctctatacccactgagaacaccgtaacatatcca
gggaatcttccgctccatctgatggcagatccattaagtgtgcccgagaccatctcccca
ccttccagtgaagaatttgaaaagcttctgcatccagaccaagacctgcatccagatctt
cacttttgccataatccagtgtga

DBGET integrated database retrieval system