KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107292899Help
Entry
107292899         CDS       T05763                                 

Gene name
SETDB1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107292899 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmur03036]
    107292899 (SETDB1)
Enzymes [BR:pmur01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107292899 (SETDB1)
Chromosome and associated proteins [BR:pmur03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107292899 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107292899 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5604 SET Tudor_4 TUDOR_5 Pre-SET MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 107292899
NCBI-ProteinID: XP_015677511
LinkDB All DBs
Position
Unknown
AA seq 1103 aa AA seqDB search
MAESEDIEELQREVVEEMGISLEDLKQLIEEELEKSEYVKQRKKELERLEDCVKQKEAEV
AHVDQLLENAVKAVDKCEVLVKDIYVNLGLEYRESDSDSENSSGKPMEVIEIPDEDDDDI
MSVDSDPSNKIAKDQTLLREAMAAMRKSAQDVQKFMDAVNKKTGSLESQRGLQHGSPGCE
LTHDGDLTVGDRVLGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDS
HPVPERLNVGSRVVAKYKDGNQVWLYAGIVAEMPNVKNKMRFLIFFDDGYASYVIQHELY
LVCRSLKKAWEDIEDVSCRDFIEEYVTAYPNRPMVLLKTGQQIKTEWEGTWWKSRVEEVD
GSLVKILFMDDKRCEWIYRGSTRLEPMFSMKTSTASTHDKKQGGQMRMRPNVGAVRTKGP
VVQYIHDLTGTSPQQQLQPAEPPVPITTAQPVPLFFGETDSESQLAQAKKQQVAKKSTSF
LRPGSVGSGLSPPASPVLSETPPVGRTGVTQQFRFSGAQPPPAGTVPSFHSMLERVPSEP
SYRAPLEKLFYLPHVCSFKCLSRVRPGRPDLHRSRNPLLIPLLHDFRRMTARRRINRKTG
FHVVYKTPCGLCLRGMGEIERYLFETECNFLFLEMFCLDPYVLVDRRFQPYKPFYYIADI
TKGREDVPLSCVNEIDSTPPPQVAYSKERLPGKGVFINTGREFLVGCDCEDGCRDKSKCA
CHQLTLQATACTPGGQLNHNSGYQHKRLEECLPTGVYECNKGCRCNLNMCTNRLVQHGLQ
VRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIES
VENSKEGYESEAKCSSDSSGVNLKDDEEPSHTGRVYGYNPNPPMPEGARRPPSKTTLHQS
RRHSEGQNPDDVLMLSSSTDSDGDNVRLTPVPVQVNPNDSDDIQTISSGSEEEGAAHEEK
KSVPSRLGQVKRQVAVKSTRGFALKSTHGIAIKSTNLASGEGAALRRNTRQFYDGEESCY
IIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYE
VGSVEGKKLLCCCGAIECRGRLL
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtccgaggacatagaagagcttcagcgggaggtggtggaagagatgggcatc
tccctggaagacctcaagcagctgattgaagaggagctggagaaatccgagtacgtcaag
cagcggaagaaggagctagaacgcctggaggactgtgtgaagcagaaggaggctgaagtg
gcccatgtggaccagctccttgaaaacgcggtgaaggcggtggataaatgcgaggtgctg
gtcaaagacatctacgtcaacctggggctggaatatcgagagtcggactccgactcggag
aacagctccggcaaacccatggaagtgattgaaatccccgacgaagatgacgatgacatc
atgagcgtagactcagatccgagtaacaaaattgcaaaagaccagaccctgctccgagaa
gccatggctgccatgaggaaatccgctcaagacgttcagaagttcatggacgcggtgaac
aagaagacgggcagcctggagtcccagagaggattacagcatggcagccctggctgtgaa
ctcacccacgatggtgacctgacggttggtgaccgtgtcctggggaagaaacgcacaaag
acctggcataagggcaccttgattgccatccagacagtgggtcctgggaagaaatacaag
gtaaaattcgacaataaagggaagagtttgctgtcgggcaaccacattgcttacgacagc
cacccggtgcccgagaggctgaatgtcggcagccgggttgtggccaaatacaaagatggc
aaccaggtctggctgtacgctggaatcgtggccgagatgcccaacgtcaagaataagatg
aggttcctgattttcttcgacgatggctacgcctcctacgtcattcagcacgagctttat
ctcgtctgcagatcactcaaaaaggcctgggaggacattgaggacgtctcctgccgggat
ttcatcgaggagtacgtcaccgcctaccccaaccggccgatggtgctgctcaagaccggg
cagcagatcaagaccgagtgggaggggacctggtggaaatcacgcgtggaggaggtggac
ggaagcctggtcaaaatcctcttcatggatgacaaacgttgcgagtggatctaccggggc
tccacccgcctggagcccatgttcagcatgaagacgtccacagcgtccacccacgacaag
aaacagggcgggcaaatgaggatgcggcccaacgtgggggccgtgcggaccaagggccca
gtggtgcagtacatccacgacctgaccggaaccagccctcagcagcagctccagcctgca
gagcccccagttcccatcaccactgcccagccggtgcccctcttctttggggagacagac
tcggagagccagcttgctcaggcgaaaaaacagcaggtggccaagaaaagcacctcgttc
ttacggcccggctcggtcggatcaggcctgtcccccccagcctctcccgtcctgagcgaa
acgccgcccgtcggccggacaggagtgacccagcagttcaggttctccggggcgcagccc
cccccggcgggcacggtgccctccttccacagcatgctggagcgggtgcccagcgagccc
tcctaccgggcgcccctggagaagctcttctacctgccccacgtctgcagcttcaagtgc
ctgagccgggtgcgccccggccgtccggacctgcaccgcagccgcaacccgctgctgatc
ccgctgctgcacgacttccggcgcatgacggcccggcggcgcatcaaccgcaagacgggc
ttccacgtggtgtacaagacgccctgcgggctgtgcctgcgcggcatgggggagatcgag
cgctacctcttcgagacggagtgcaacttcctcttcctggagatgttctgcctggacccc
tacgtgctggtggaccggcgcttccagccctacaagcccttctactacatcgcggacatc
accaagggccgggaggacgtgcccctctcctgcgtcaacgagatcgacagcaccccgccg
ccccaggtggcctacagcaaggagcgcctgcccgggaagggggtcttcatcaacaccggc
cgggagttcctggtgggctgcgactgcgaggacggctgcagggacaaatcgaaatgcgcc
tgtcaccagctgacgctccaggccacggcttgcactcccggcgggcagctcaaccacaac
tctggctaccagcacaagcggctggaggaatgtcttcccacgggggtgtacgagtgcaac
aagggctgcaggtgcaatttgaacatgtgcaccaaccgcctggtccagcacggcctgcaa
gtccggctgcagctcttcaagacgcagaacaaaggctggggcatccgatgcctggacgac
atcgccaagggctccttcgtctgcatctacgccgggaagatcctgacggacgactttgcg
gataaggagggcctggagatgggggacgagtatttcgccaacctggaccacatcgagagc
gtggagaactcgaaggagggctacgagagcgaggccaagtgctcctcggacagcagcggc
gtcaacctgaaggatgacgaggagcccagccacaccggccgggtctacggctacaacccc
aacccgcccatgcccgaaggggcccggcggccccccagcaagaccaccttgcaccagagc
cgcaggcactccgaggggcagaatcctgacgacgtgctgatgctctccagcagcaccgac
agcgacggcgacaacgtccggctgaccccggtgcccgtccaggtcaaccccaacgacagc
gacgacatccagaccatctcctccggctcggaggaagaaggggccgcccacgaggagaag
aagagcgtgccttcccggctggggcaggtaaagaggcaggtggcggtgaaatccacccgg
ggcttcgccttgaaatccacgcacggcatcgccatcaagtccaccaacttggcctccggg
gagggcgcggccctccgcaggaacacgcgccagttctacgacggggaggagtcctgctac
atcatcgacgccaagctggagggcaacttgggccgctacctcaaccatagctgcagcccc
aacctcttcgtccagaacgtcttcgtggacacgcacgacctccgctttccctgggtggcc
ttcttcgccagcaagagaatccgggctgggacggagctcacctgggattacaactacgaa
gtaggaagtgtcgaaggcaaaaaactcttgtgttgttgtggtgccatcgaatgccgaggc
cgcttgttgtaa

DBGET integrated database retrieval system