KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107293789Help
Entry
107293789         CDS       T05763                                 

Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00010  Glycolysis / Gluconeogenesis
pmur00051  Fructose and mannose metabolism
pmur00052  Galactose metabolism
pmur00500  Starch and sucrose metabolism
pmur00520  Amino sugar and nucleotide sugar metabolism
pmur00524  Neomycin, kanamycin and gentamicin biosynthesis
pmur01100  Metabolic pathways
pmur01200  Carbon metabolism
pmur04910  Insulin signaling pathway
Module
pmur_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pmur_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107293789
   00051 Fructose and mannose metabolism
    107293789
   00052 Galactose metabolism
    107293789
   00500 Starch and sucrose metabolism
    107293789
   00520 Amino sugar and nucleotide sugar metabolism
    107293789
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107293789
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107293789
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmur04131]
    107293789
Enzymes [BR:pmur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107293789
Membrane trafficking [BR:pmur04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107293789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 107293789
NCBI-ProteinID: XP_015678455
LinkDB All DBs
Position
Unknown
AA seq 889 aa AA seqDB search
MRLSDETLLDIMGRFRNEMKNGLSRDFNATASVKMLPTFVRSIPDGSEKGDFIALDLGGS
FFRILRVKVSHEKKQMVQMETEIYETPEDITHGSGTRLFDHVAECLGDFMEKQEIKDKKL
PVGFTFSFPCRQSKLDEGVLITWTKRFKASGVEGADVVNLLNKAIKKRGDYDADIMAVVN
DTVGTMMTCGFDDQRCEVGLIIGTGTNACYMEEMRHIDLVEGDEGRMCINTEWGAFGDDG
LLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPEL
LTKGKLETKDVSAIEKSKEGLHKAKDILTRLGVEPSHEDCIAVQHVCTIVSFRSANLVAS
TLGAILSQLRDNKGVGRLRTTVGVDGSLYKMHPQYARRLHKMVRRLVPDSDVRFLLSESG
SGKGAAFVTAVAYRLAEQHRLIAETLAEFKLTNEQLLQVKKRMRIEMEAGLKKKSHDHAK
VKMLPTFVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRMVEMHNKIYSIPVEVMQ
GTGDELFDHIVTCISDFLDYMGIKGACLPLGFTFSFPCKQTSLDCGILLNWTKGFKATDC
EGEDVVNLLRDGIKRREEFELDVVAVVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYME
EARNVEMVEGDQGRMCVNMEWGAFGDSGCLDDIRTIYDKAVDEYSLNSGKQRYEKMISGM
YLGEIVRNILIDFTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRTILQQLG
LNSTCDDSIIVKAVCGAVSRRAAQLCGAGMAAVVDKIRENRGLEHLDVTVGVDGTLYKLH
PHFSKFMHKTVKDLAPKCNVTFLLSEDGSGKGAALITAVGCRLRDAEHN
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgtcggatgaaactttgctggatattatgggtcgcttcaggaatgaaatgaag
aatggcctctctagggattttaacgcaacagccagtgtaaagatgctgcctacctttgta
aggtctattcctgatggctcagagaaaggagatttcattgctctggatcttggtggctct
ttcttccgaattttgagagtaaaagtctcacacgagaaaaagcagatggtgcaaatggaa
actgagatttacgaaacgccagaagatattacgcacggcagtggcacacggctttttgat
catgttgctgaatgtctgggagacttcatggagaaacaagaaattaaggacaagaaatta
cctgttgggttcacattttcattcccatgtaggcaatctaaactagatgagggtgttctg
attacctggacaaaacgtttcaaagcaagtggtgtcgaaggagctgacgtagtgaatctc
ttaaacaaagccatcaagaaacgtggggattatgatgcggacatcatggcagtggttaat
gacactgttgggacaatgatgacctgtggatttgatgaccagcgttgcgaagttggctta
attatcgggactggtacaaatgcctgctatatggaggaaatgaggcacattgatctggtg
gaaggtgatgaaggccgcatgtgcatcaacaccgaatggggtgcatttggagatgatggc
ttattagaagacatccggactgaatttgacagagagattgatcggggttcccttaatcct
gggaagcaactatttgaaaagatggtcagtggaatgtacatgggtgaacttgtcaggctt
atccttgtaaaaatggccaaagaaggtctcctttttgaggggcgaatcactcctgaactt
ttgaccaaagggaaattggaaactaaggatgtttctgccatagagaagagcaaggaaggt
ttgcataaagccaaagacatactaacacgtcttggggttgagccttcccatgaagactgc
atcgctgtccagcacgtgtgcaccattgtgtcgttccgctctgcaaacttggtggcaagt
actctgggtgctatcctgagtcagctgcgagacaataaaggagttggccggctgcgcacc
acggtgggggtggacggatccctttacaagatgcatccgcaatatgccaggcgcctgcac
aaaatggtgcgacgcttagtgcctgattccgatgtgcgtttcttgctctctgagagtggc
agcggaaagggggcggccttcgtgaccgcagtagcttatcggctggcagagcagcaccgg
ttgattgcagagaccctggcagaattcaagctcaccaacgaacagctgcttcaggtgaag
aagcggatgaggatcgagatggaggccggcctcaagaagaagtcacacgaccatgccaag
gtcaagatgctgcccacctttgtccgcagcacccctgatgggacagagaatggagacttc
ctggctctggatcttggtgggacaaatttccgtgttttgctggtgaagatccgaagtggc
aaaagaaggatggtagaaatgcacaataaaatatattcaatccctgtagaagttatgcag
gggactggagatgagctgttcgatcacattgtcacctgcatttcggacttcctggattac
atgggaataaaaggagcttgcctccctctgggctttacgttttctttcccctgcaaacag
accagcctagattgtggtatccttttgaattggaccaagggctttaaggctactgactgt
gaaggagaggatgttgttaatttactaagagatggaattaaaagaagagaggaatttgaa
ctggatgttgtggctgtagtgaatgatacagttggaactatgatgacttgtgcctatgaa
gatccgaattgtgaaataggactcattgtgggaactgggagcaatgcctgctacatggag
gaagccagaaatgttgaaatggtggagggagaccagggcaggatgtgtgtgaacatggaa
tggggtgcctttggggacagcggatgcctagatgatatcaggacaatctatgacaaagct
gtggatgaatattcactaaatagtggcaagcaaaggtatgagaagatgatcagtggaatg
tatttaggggaaattgtccgtaacattttgattgacttcacaaaaagaggattcctcttc
agaggtcaaatttcagaaacactgaaaactaggggcatttttgaaaccaagtttctttca
cagattgagagcgataggttagcgttgcttcaggtccgtaccatcctccagcagcttggc
ctgaatagcacttgcgatgacagtataattgtgaaggcagtatgcggagctgtgtcgcgg
agagcagctcagctgtgtggcgctggaatggctgctgttgtagataaaataagggagaac
agaggcttggagcatctggacgtaaccgtgggcgtagatggcacactatacaaacttcat
ccacacttttcaaagttcatgcacaaaacagtaaaggatctggcacccaaatgcaacgtg
acattcctgctttcggaagacggcagcggcaaaggagccgccctcatcactgcggtggga
tgccgattgcgcgatgcagagcacaactga

DBGET integrated database retrieval system