KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107294605Help
Entry
107294605         CDS       T05763                                 

Gene name
SRM
Definition
(RefSeq) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00270  Cysteine and methionine metabolism
pmur00330  Arginine and proline metabolism
pmur00410  beta-Alanine metabolism
pmur00480  Glutathione metabolism
pmur01100  Metabolic pathways
Module
pmur_M00034  Methionine salvage pathway
pmur_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107294605 (SRM)
   00330 Arginine and proline metabolism
    107294605 (SRM)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107294605 (SRM)
   00480 Glutathione metabolism
    107294605 (SRM)
Enzymes [BR:pmur01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     107294605 (SRM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_31 Methyltransf_25 Methyltransf_18 Methyltransf_12
Motif
Other DBs
NCBI-GeneID: 107294605
NCBI-ProteinID: XP_015679332
LinkDB All DBs
Position
Unknown
AA seq 294 aa AA seqDB search
MAPAGIRNGSSGDLQWLQRSEREAGPGGALLCSRPSPAPVLAGPSPLYSKTYGNVLVLDG
VIQCTERDEFSYQEMIANLPLCSHPNPRKILIIGGGDGGVLREVVKHPSVESVIQCEIDE
DVIQASKKYLPGMAVGYSSPKLTLHVGDGFEFMKQNQEAFDVIITDSSDPMGPAESLFKE
SYYQLMKTALREDGILCCQGECQWLHLDLIKEMRQFCKSLFPVVEYAYCTIPTYPSGQIG
FMLCSKNPNTNFREPVQLLSQEEVEQMSLKYYNSDIHRASFVLPEFARKALSTV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggctccagcggggatccgcaatggctccagcggggatctgcaatggctccagcggagc
gagcgggaagcggggcccggcggggctttgctgtgcagccgacccagcccagctcccgtc
ctggcgggaccctctcccctttacagcaaaacctacgggaacgtcctggtcctggacgga
gtcatccagtgcaccgagagggatgagttctcctaccaagaaatgattgccaatctcccg
ctgtgcagccatccaaatcctcggaagattctaattatcggcggtggcgacggaggcgtc
ttaagagaagtggtgaagcatccttcagttgagtcggtaatacagtgtgaaatcgatgag
gacgtgatccaggcctcgaagaaatatctcccgggcatggcggtgggctattccagcccg
aagctgaccctccacgttggggacggctttgagttcatgaagcagaaccaagaagctttt
gacgtgatcatcaccgattcttctgaccccatgggtcctgccgaaagcctgtttaaggaa
tcctactaccagctgatgaaaaccgccctgcgggaagatgggatcctctgttgccaaggg
gaatgccagtggttgcaccttgacctcataaaggagatgcgccagttctgtaaatctctc
tttccggtggttgagtacgcctactgcaccatcccgacctatcccagtggccagattggc
ttcatgctttgcagcaaaaatccaaacaccaacttcagggaaccggtccagctactttcc
caggaagaagtagagcaaatgagccttaagtattacaactcggacatccaccgagcctct
ttcgtcctgccggagttcgcacgaaaggcactgagtaccgtgtaa

DBGET integrated database retrieval system