KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107294901Help
Entry
107294901         CDS       T05763                                 

Definition
(RefSeq) netrin receptor DCC-like
  KO
K06765  deleted in colorectal carcinoma
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Pur_ac_phosph_N Interfer-bind DUF2369 DUF4912
Motif
Other DBs
NCBI-GeneID: 107294901
NCBI-ProteinID: XP_015679655
LinkDB All DBs
Position
Unknown
AA seq 374 aa AA seqDB search
MFSGKLLGLVCNHFNIKGSKGEWLNAIMSIKVSWLPPPSNMQNGFITGYKIRHRKTARRG
EIETLEPNNLWYLFTGLDKGSQYSFQVAAMTANGTGPSSEWYTAETPESDLDESQVPDQP
SSLHVRPLSTSIVMSWTPPLNPNIIVRGYIIGYGVGSPYAETVRVDSKQRYYSIEHLEPS
SHYVISLKAFNNAGEGVPLYESATTRSLTGYNSWICNVKMRPCKKEMSADTTALSHTVSG
LKPNTMYEFSVMVTKGRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKPRAVIVSWQP
PLEANGKITAYILFYTLEKNSPIDDWIMETISGDRLTHQIMELNLDTVYYFRIQARNAKG
VGPLSDPILFRTLK
NT seq 1123 nt NT seq  +upstreamnt  +downstreamnt
atgttttctggaaagctgttgggtttggtgtgcaatcatttcaacataaagggcagtaag
ggagaatggttaaatgccattatgagcatcaaagtgagctggctacccccaccgtccaac
atgcaaaatggatttatcactggctataaaatacggcacagaaagacagctcgcaggggt
gagatagaaacattggagccaaataacctctggtatctgtttacaggtcttgacaaagga
agccagtatagtttccaggttgcagctatgacagccaatggaacgggaccttcttcagag
tggtatactgcagaaactccagagagtgatcttgatgaatctcaggtgcctgaccagcca
agctctcttcacgtcaggcctttgtcaaccagcattgtaatgagctggacaccaccattg
aatccaaacatcattgtacgtggctacatcattggctatggggtaggcagcccctatgcc
gagacagtccgggtggacagcaaacagcgatattattccattgaacatctggaaccaagt
tcccattatgtcatatctctgaaagcattcaacaatgctggggaaggagtacctctttat
gagagtgctaccaccagatcactgacaggttataactcttggatctgcaatgtcaagatg
agaccatgtaaaaaagagatgtcagcagatacaacagccttgagccataccgtgtctggt
cttaaaccaaataccatgtatgagttctctgtcatggtgaccaaaggtcggaggtcaagt
acatggagcatgacagctcatgctacaacatatgaagcagccccgacctctgctcccaag
gatttgacagtcattacccgtgagggcaagcctcgagctgtaattgtcagctggcaacct
ccattagaagccaatgggaaaattactgcttacattctgttctacaccttggaaaagaat
tcccccattgacgattggatcatggagaccatcagtggagaccgacttacgcatcaaatt
atggagctgaacctggatacagtatattacttcagaatacaagctcgaaatgccaaaggc
gtgggacctctctctgaccctattctcttccggactctgaaag

DBGET integrated database retrieval system