KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107295717Help
Entry
107295717         CDS       T05763                                 

Definition
(RefSeq) integrin beta-5-like
  KO
K06588  integrin beta 5
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04145  Phagosome
pmur04510  Focal adhesion
pmur04512  ECM-receptor interaction
pmur04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    107295717
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    107295717
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107295717
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107295717
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pmur04131]
    107295717
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pmur04515]
    107295717
Membrane trafficking [BR:pmur04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    107295717
Cell adhesion molecules [BR:pmur04515]
 Integrins
  Integrin beta subunits
   107295717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_B_tail I-EGF_1 EGF_2
Motif
Other DBs
NCBI-GeneID: 107295717
NCBI-ProteinID: XP_029141739
LinkDB All DBs
Position
Unknown
AA seq 614 aa AA seqDB search
MPQKISLNLQPGDPASFHVQVRQVEDYPVDLYYLMDLSLSMKDDLDTIRNLGTKLAEEMG
KLTSNFRLGFGSFVDKNISPFSYTAPRYQNNPCTGYKLFPNCVPSFGFRHLLSLTDEIDR
FNEEVQKQKVSRNRDAPEGGLDAILQAAVCEKEIGWRKEASHLLVFTTDDVPHIALDGKL
GGLVQPHDGLCHLNEANEYTASNQLDYPSLALLGEKLAENNIHVIFAVTKNHYMLYKNLT
ALIPGTTVEILYQDSRNIIQLIVKAYNSIRSKVELTVRDSPNDINLAFTATCQDGSSYPG
ARKCGDLQIGDTVSFEIAVEAWTCPAENISHTFTIKPDWFRDTVEVTVSYNCTCGCTKQT
EHNSSKCSGNGTHVCGLCDCNPGHVGAKCECEEGDSGAMYHNMCREAEGKRICSGRGECS
CHRCVCYKSEFGRIYGFFCECDDFSCPRYKGFLCSGHGECHCGECKCHPGYIGDNCNCST
DTGRCLSNDGQMCSGRGNCICGKCQCTEPGAFGETCEKCPTCPGVCSTKRDCIECILFNS
GRLADNQTCQKHCRDEIITRVDFLKTDDPNSILCAYPVKDCVMKFTYSELTNGKTNISVL
KEPGIYLSACFFLL
NT seq 1844 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaaaagatctctctgaatctgcagcctggtgacccagcctctttccatgtgcag
gttcgacaggtagaggattatcccgtggatttgtattatttgatggatctctccctctcc
atgaaggatgatctggacaccattcggaacttgggaactaagctggctgaagaaatggga
aagctcaccagcaatttccggcttggtttcggctcttttgtagacaagaacatttctccc
ttctcctacaccgccccaagataccagaataacccctgtactggatataagttattccca
aattgtgtcccatcctttgggttccgccatcttttatccctcactgatgaaattgataga
ttcaatgaagaagttcagaaacagaaggtttcccgcaacagagatgctccagagggtggc
ttagatgcaatcttgcaagctgctgtgtgtgaaaaagaaattgggtggcggaaggaggct
tcacatttgctggtcttcactactgatgatgtcccacacattgcgctggatggaaagctg
ggcggtttggtgcagccacatgatgggctgtgtcacctgaatgaggccaacgaatacaca
gcgtccaatcagctggattatccgtcacttgcacttcttggagaaaaattagctgaaaac
aacattcatgtcatttttgcagtgaccaaaaatcactatatgctttacaagaatctcacg
gccctaattcctggaacaacggtcgagattttgtatcaagactcccgaaatattatccag
cttatagtcaaggcctacaatagtattagatcaaaagtagagttaactgtccgggatagt
cctaatgacattaacttggctttcacagccacatgtcaagatggttcatcatatcctgga
gccaggaagtgtggagatcttcaaataggagacacggtgtcctttgagatagcagtagag
gcttggacatgcccagctgagaacatctcacacaccttcactatcaaaccagattggttt
cgggacactgtagaggtgaccgtttcttacaactgcacatgtggatgtaccaaacagaca
gagcacaacagcagtaaatgtagtggaaatggcacccatgtgtgtggattatgtgattgt
aacccaggccatgtaggagccaagtgtgaatgcgaggaaggagacagtggggccatgtac
cacaacatgtgccgagaagctgaagggaaacgtatctgcagtggccgtggggagtgctcc
tgccaccgctgtgtgtgctacaaaagtgaatttggcaggatctacgggttcttttgtgag
tgtgatgacttctcctgtccaagatataagggctttctctgctcaggtcacggagaatgt
cactgcggggaatgtaagtgccatcctggctatattggggacaactgcaactgctcaacg
gacacaggccggtgtctttctaacgatggccaaatgtgcagtggccgaggcaactgcatc
tgtgggaaatgccagtgcactgaacctggagcttttggggagacttgtgagaagtgtccc
acctgcccgggtgtttgcagtactaaaagggactgcattgagtgtatcctgttcaactca
ggaaggctggctgataaccaaacctgccaaaaacactgccgggatgaaattataacacga
gtagattttcttaaaaccgatgaccctaattcaatcttatgtgcttatccggtgaaggat
tgtgtaatgaaattcacatactcagaactcaccaatggaaagacaaatatcagtgttctc
aaggaaccaggtatttatttatctgcttgctttttcttattgat

DBGET integrated database retrieval system