KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107295878Help
Entry
107295878         CDS       T05763                                 

Gene name
KMT5B
Definition
(RefSeq) histone-lysine N-methyltransferase SUV420H1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107295878 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmur03036]
    107295878 (KMT5B)
Enzymes [BR:pmur01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107295878 (KMT5B)
Chromosome and associated proteins [BR:pmur03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107295878 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF3970
Motif
Other DBs
NCBI-GeneID: 107295878
NCBI-ProteinID: XP_015680698
LinkDB All DBs
Position
Unknown
AA seq 860 aa AA seqDB search
MKWLEESKNMVVNGRRNGSRLSNDHHQNQSKLQHSGKENPKTGKNGVERRSSRCSGGSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTRFRPIKGRQEELKEVIER
FKKDEHLEKAFKSLTSGDWARHYFLNKNKMQERLFKEHVFIYLRMFATDSGFEILPCNRY
SSEQNGAKIVATKEWKRNDKIELLVGCIAELSELEENMLLRHGENDFSVMYSTRKNCAQL
WLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEYCECYT
CERRGTGAFKSRVGLPAPTPVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDAD
TTQEKANATTRKSSIGVKKNSKNRTLTRQSISRIPTSSNSTSSRLTHLDNSRVPKRLKKP
AKPLLSKIKLRNQYKRPEQKNASRKLEMGNLVLKEPKIVLYKNLPIKKEKETEGPVKVAM
SSGCLTRHAAREYKLNSVKGAHEPGEISPCTYITRRSMRTRTNLKETSDLKLEPNMLNSY
KNSLTGMQANSLEPQSHVILESEQSLIATQKAEGRCQKSERIVAKKKSRQGRLVKPSAKM
EETDCAHTLTGKDKLPDLISSHSDLGEINSVMDSAIGYKDCIPASGGCSIVTSDTFKVKE
RFRTAKSKKKRRITRYDAQLILENSSGIPKLTLRRRHDSNSKTNDQENDGMNSSKISIKL
SKDHEKDNNLYVAKLNNGFNSGSSSSSTKLKIQLKREEENRGTYSDDLHENGVCCSDPLS
LLESRMEVDDYSQYEEETIDDSSSAEEEEEEEEDEYEDDFEDDFIPLPPAKRLRLIVGKD
SIDIDISSRRREDQSLRLNA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttggaagaatccaagaacatggtggtgaatggccggagaaatggaagcagg
ttatctaatgaccaccatcaaaatcagtccaaattacagcattctggaaaggaaaatcca
aagactggcaaaaatggagttgagagacggtccagcagatgtagtggtggttcgggattt
gaaggccaaagtcgctacgtgccttcttctggaatgtctgccaaggagctatgtgagaat
gatgacctagcaactagtttggttcttgatccatatttaggctttcaaacacataaaatg
aacactaggtttcgaccaataaaaggaagacaagaggaactgaaggaggtgattgagcgt
tttaaaaaagatgagcacttggaaaaagccttcaagtccttgacgtcaggtgactgggcc
cggcactattttcttaacaagaacaaaatgcaggaaaggttgttcaaagaacacgtattt
atttatttacgaatgtttgcaactgacagtggatttgaaatattgccatgcaatcgctat
tcatcagagcaaaatggagccaaaatagttgcaacaaaagagtggaaacgaaatgacaag
atagagctattagtaggttgtattgctgaactctctgaactagaagagaatatgctgctc
agacatggagaaaatgacttcagcgtcatgtattcaacacggaaaaactgtgctcaactg
tggctcggtccagctgctttcattaatcatgattgcagacccaactgtaagtttgtttca
actggccgggatacagcatgcgtgaaagctttgcgagatattgaacctggggaggaaatt
tcttgctattatggagatggcttttttggagaaaataatgaatattgtgaatgctacaca
tgtgaaagacgtggaactggtgcttttaaatcaagagtgggactgcctgcacctactcct
gtgatcaatagcaaatatggactcagagaaacagataaacgtttaaacaggcttaagaaa
ttgggtgatagcagtaaaaattctgacagtcaatctgtcagctctaacactgatgcagat
accactcaggaaaaagctaatgcaactacccggaaatcatcaattggtgtaaaaaagaac
agcaagaatagaacattaaccaggcagtctatttcaagaattccaacttcatcaaattct
acctcatccagactaactcatttagataattccagggtaccaaagagactgaaaaagcct
gcaaagcctttactttcaaagataaagttgcgaaatcagtacaaaaggccagaacaaaaa
aatgcatctaggaaactcgaaatggggaatttggttcttaaagaacccaaaatagttcta
tataaaaatttgcccattaagaaggaaaaagaaacagagggaccagtgaaagttgcaatg
tctagtggctgcttaacaaggcatgcagcgcgagaatataaattaaattcagtgaaaggt
gctcatgaacctggggaaatatcaccctgtacatacataacacggaggtcaatgagaaca
cgaacgaatctgaaagagacctccgacttaaagcttgaaccaaatatgctaaatagctat
aaaaacagtttgacaggcatgcaagccaatagcttggaaccgcagtctcatgtgattttg
gagagcgagcaatctcttatagcaacacagaaggcggaggggaggtgtcagaagagtgaa
agaattgtggccaaaaagaaatctcgacaagggagactggtgaagccatcggcaaaaatg
gaggaaacggattgtgcacatacgctgactggcaaagataaattgccagatttgattagt
tcacattctgacctaggagagataaacagtgtgatggattctgccatcgggtataaagac
tgtattcctgcatctggtggctgttccattgtaacttctgacactttcaaagtcaaagag
cgctttagaactgcaaaaagtaaaaagaaaaggcgaatcacaaggtatgatgcacaactc
attcttgaaaacagctctgggattcccaaacttactctgcgaaggcggcatgatagcaac
agtaagactaatgaccaagaaaatgatggaatgaattcttcaaaaataagcatcaaatta
agtaaagaccacgagaaagataataatttatatgtagcaaagcttaataatgggtttaac
tcaggatcaagtagtagttcaacaaaattaaaaatacagctaaaacgagaagaagaaaat
aggggaacttactcggatgaccttcatgagaacggagtgtgttgcagtgatcctctttca
ctactagagtcacggatggaagtggacgattatagtcaatatgaagaagaaactattgat
gattcttcatctgcagaagaggaggaggaagaggaggaggacgaatatgaggatgatttt
gaggatgattttattcctctgcctccagctaagcgtttaaggcttatagttggaaaggac
tcaatagacattgacatttcttccaggagaagagaagatcagtctttaaggctcaatgca
taa

DBGET integrated database retrieval system