KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107296204
Entry
107296204         CDS       T05763                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00220  Arginine biosynthesis
pmur00330  Arginine and proline metabolism
pmur01100  Metabolic pathways
pmur04020  Calcium signaling pathway
pmur04146  Peroxisome
pmur04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107296204 (NOS2)
   00330 Arginine and proline metabolism
    107296204 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107296204 (NOS2)
   04020 Calcium signaling pathway
    107296204 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107296204 (NOS2)
Enzymes [BR:pmur01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     107296204 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 107296204
NCBI-ProteinID: XP_015681039
LinkDB
Position
Unknown
AA seq 807 aa
LCIQLGWKAKYGCFDVLPLVLQANGQDPELFELPPELILEVSMEHPTYEWFKDLDLKWYA
VPAVSNMLLEIGGLEFTACPFNGWYMGTEIGVRDFCDARRYNILQEVGRRMGLETNKLSS
LWKDKAVVEVNVAVLHSFQKQSITIMDHHSAAESFMKYMQNEYRIRGGCPADWVWLVPPI
SGSITPLFHQEMLNYIISPFYYYQVDAWKTHIWKDEKHKPKKRKIRFCIWAKAVFFASLL
MRRAMAVRIKATVLYATETGKSETLARKLGDMFNCAFSTKVTCMGDYNLRDLEKETLLLV
VTSTFGNGDAPSNGKTLQNALLSMKQLSNKFRYAVFGLGSSMYPEFCAFARLVHQKLAQL
GAFPISPMGEGDELNGQEEAFRNWAILTFQTACETFDIRGKHRILLPKEYTCKETWNPKN
FRIVYDSQPLALEKALGDIHGKNVVPLILKFRQNLQSSQSSRVTMLIKLSCETNQEINYL
PGDHLGIFPENQKALVDGIISHVADAPPFNEIIRLEACCDRDYWTPYKKFPACTLAQALM
HFLDVTSPPSQQLLRSFSQLAKDENEKERLNLLCHNLEEYNKWKFYNSPTILEVLEEFPS
IRISTSFLLSQLPLLKPRYYSISSSQDWEPQELHLTVAVVTYRSKNGKGPVHHGVCSTWL
NTMDLKKTIPCFIRSADGFRLPKDPRKPCILIGPGTGIAPFRSFWQQRLFDLENKGIQGR
GLILLFGCRHSNLDHLYREEMAEMHQKGILQAVYTAYSREPGSPKRQKRYKEDIFGATFP
KENQRNMEEIKTERPTEVLESQAQLKL
NT seq 2424 nt   +upstreamnt  +downstreamnt
ctctgcatccagcttggctggaaagccaaatatggctgctttgatgtgcttccactggtc
ctgcaagccaatggtcaagacccagaattatttgaattgccgccagagctcatcctggag
gtgtcgatggagcatcccacatatgaatggtttaaagacttggacttgaagtggtatgcg
gtcccagctgtgtctaatatgctccttgaaattggtgggttggaatttacagcttgtcct
ttcaacggctggtacatggggactgagattggggtacgggacttctgcgacgcccggcgc
tacaatattcttcaggaagtggggagaaggatgggcttggaaacaaataaactctcttcg
ctgtggaaagacaaagccgtcgtagaggttaacgttgccgtgctccatagttttcagaag
caaagcatcaccatcatggaccaccattctgctgctgaatcattcatgaaatatatgcag
aatgaatatcggatccgcggtgggtgtccggcagattgggtttggctggttcctcccatc
tccggtagcattacgcctctcttccaccaggagatgttgaattacattatttcaccattc
tattattatcaggtggatgcatggaaaacacatatctggaaagatgagaaacacaagcca
aagaaaagaaaaatcagattctgcatatgggccaaggccgtgttttttgcatccttgttg
atgcgaagagccatggcagtcaggatcaaagcaacggtgctctatgccacagaaacgggg
aaatcagagactctagctcgaaagctgggtgacatgttcaattgtgccttcagtaccaag
gttacctgtatgggtgattacaacctaagagaccttgagaaggaaactcttcttctggtg
gtcaccagcacttttggaaatggcgatgccccaagcaatggcaaaactctgcagaatgcc
ctcttgtctatgaaacaactgagtaacaaattccggtatgcagtttttggcttgggttca
agcatgtatccagaattctgtgcctttgcccgtcttgtgcaccaaaaacttgcacagttg
ggggcatttccaatcagcccaatgggtgaaggagatgaactcaatgggcaagaagaagct
tttcggaactgggccattcttacatttcagacggcctgtgaaacttttgatatccgcgga
aagcacaggatcctgttaccaaaagaatatacatgtaaagaaacctggaaccccaagaat
tttaggattgtatatgactctcagccgttggctttagagaaagcacttggtgatattcat
gggaaaaatgtagttccactgatcctcaaatttcggcagaatcttcaaagttcacagtcc
agccgtgttaccatgctaattaaactttcctgtgaaaccaatcaggaaatcaactatctc
ccaggagaccatcttgggatcttccctgaaaaccaaaaagctttggttgatggcatcata
tcccatgttgcagatgctcctccattcaatgaaatcattagactggaagcatgctgtgat
cgtgactactggactccttacaaaaagtttccagcatgtacactggcacaagctttgatg
catttccttgatgtaacctctcctccttcccagcagttgctaagatctttttcccagctg
gcaaaagatgaaaatgagaaggaaaggctgaatctcttgtgtcataatttggaggaatac
aacaagtggaaattttacaacagccctactatcttggaagtcctggaggaattcccatcc
atcaggatctcaacatcctttttactctctcagctgcctttactcaagcccagatattac
tcgatcagttcttcgcaggattgggagcctcaggaattacatttgactgtggcagtggtg
acctatagatctaaaaatggaaaaggtccagtgcaccatggggtttgcagtacttggctg
aacacgatggacctgaaaaagacaatcccctgttttattcgcagtgctgatggatttcga
cttccaaaggatccaaggaaaccctgtatcctgattggtcccggcacaggaattgctcct
tttagaagcttctggcaacaacgactttttgacttagaaaataaagggatccaagggagg
ggtctgatcctgctgttcggctgccgacactccaacctggaccacctctatcgagaagaa
atggcggagatgcatcagaaagggattctccaagcggtctacacagcttactccagggag
cctgggagtcccaaaaggcagaaacgctacaaggaggacatatttggagcaacgtttcca
aaggagaaccaaagaaacatggaagaaataaaaactgaaagacccacagaagtcttggaa
tctcaagcccagctaaaactttag

DBGET integrated database retrieval system