KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107296922
Entry
107296922         CDS       T05763                                 

Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C-like
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur00310  Lysine degradation
pmur01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107296922
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmur03036]
    107296922
Enzymes [BR:pmur01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     107296922
Chromosome and associated proteins [BR:pmur03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107296922
SSDB
Motif
Pfam: SET
Other DBs
NCBI-GeneID: 107296922
NCBI-ProteinID: XP_015681765
LinkDB
Position
Unknown
AA seq 546 aa
MGSTRLTAKELCENDDLATTLILDSYLGFRTHKMNVSPLPAIRRKHHLREAVEAFRKRKD
LEAAYQALMQGGWACQYFANRSHQQEAAFKSHIFRYLRIFLPESGFAIRRCSRYSLEING
AQVVSTKSWRKNDKLELLEGYIAELTEPDESLLRAGENDFSIMYSTRKQCAQLWLGPAAF
INHDCRPNCKFVPMDGNTACVKVLRDIEPDDEITCFYGDGFFGENNELCECHTCERKGEG
AFRLLNQTPLVATSVNEKYLLRETDGRLQRWKKQSCKHAQRNVKAGHKTRRRKSQLHGAV
HRYTTRWYLKMLKPLHIPLHNCLACRARGCKLRKQPLVCLLPPLPVLHLRQSLINKNCHS
ETQQDCSLTKMHNGPESPGVANQGSLVVNLGKRIPLDWARFHREVACDIKEEKLSNTNEE
FSQGTEEYDSKDMEESHADVKETHESGSGVLHSGEQVPPDSSGSLSSGQFLCRTRSMAQC
QAHVLPQSQLSLPMVDPKLSQYAHVRLEGPLFGGRQCWQQLPSDKVEKEQAEEQHLPKRM
VPSTLR
NT seq 1641 nt   +upstreamnt  +downstreamnt
atgggctccactcggttaactgcaaaagaactatgtgagaacgatgaccttgccacaacg
ctaattcttgactcctaccttggctttaggactcataaaatgaatgtaagcccactccca
gccatcaggaggaagcaccatttacgggaggcagtagaagctttccggaagcgcaaggac
ctagaagcagcatatcaagccttgatgcagggtggctgggcctgccagtattttgcaaac
cggagccatcagcaggaagctgccttcaagagtcatatttttcggtaccttcgcattttc
cttcctgagagcggttttgccatcagacgttgtagtcgatattccttagaaataaatgga
gcccaggtagtgtctacaaagtcatggagaaagaatgataaactggagcttttagagggc
tacattgcagaactgacagaacccgatgagagcctcctccgagcaggtgaaaatgacttc
agcatcatgtactccacccggaaacagtgtgcccagctttggctagggcctgcagccttc
attaatcatgactgcagaccaaactgtaagtttgtcccaatggatgggaacacggcttgt
gtcaaggtgctgcgggacattgagccagatgatgagatcacatgcttctatggcgacggc
ttctttggggagaacaatgaattatgcgaatgccacacttgtgaaaggaagggggaagga
gcttttcgcctcctgaatcagacaccattggtagctacctcagtcaatgagaaataccta
ctgagagagacagatggccgtctgcagaggtggaaaaagcagtcttgcaaacatgctcaa
cgtaatgtgaaagcgggacacaaaacccggcgcaggaaatcacaattacatggtgctgta
cacagatataccactcgctggtatcttaagatgctgaagcctttacacatcccgctgcac
aactgcttggcctgcagagcacgtggatgcaagctccgtaagcagcctctggtgtgtctg
cttcctccgttgcctgtattgcacctcaggcagtctttgataaacaagaattgccactcc
gagacccagcaagactgctctcttacaaagatgcacaatggccctgaaagcccgggcgtg
gccaatcagggcagcctggtagtgaatctcgggaagagaattcccttggactgggcaagg
tttcatagggaagtagcatgtgacattaaagaagaaaaactttctaacactaacgaggag
tttagccaggggaccgaggaatatgattcaaaggatatggaggaaagtcatgctgatgtt
aaagaaacccatgaatcaggatctggggttctccattcaggagagcaagtcccccctgat
tcttcaggttctctttcatccggtcagtttttgtgcagaacaagaagcatggctcagtgc
caagctcacgttttgccccaatctcagttgtcattaccaatggtagaccccaagctttcc
cagtatgctcacgtccgcctggaaggcccactttttggaggcaggcagtgctggcagcag
ctcccttcagacaaggtggagaaggaacaagccgaggaacagcatcttcctaagcggatg
gttccatcaaccttgaggtag

DBGET integrated database retrieval system