KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107297118
Entry
107297118         CDS       T05763                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04010  MAPK signaling pathway
pmur04137  Mitophagy - animal
pmur04210  Apoptosis
pmur04218  Cellular senescence
pmur04620  Toll-like receptor signaling pathway
pmur04621  NOD-like receptor signaling pathway
pmur04622  RIG-I-like receptor signaling pathway
pmur04623  Cytosolic DNA-sensing pathway
pmur04625  C-type lectin receptor signaling pathway
pmur04920  Adipocytokine signaling pathway
pmur05132  Salmonella infection
pmur05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107297118 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107297118 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    107297118 (RELA)
   04218 Cellular senescence
    107297118 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107297118 (RELA)
   04621 NOD-like receptor signaling pathway
    107297118 (RELA)
   04622 RIG-I-like receptor signaling pathway
    107297118 (RELA)
   04623 Cytosolic DNA-sensing pathway
    107297118 (RELA)
   04625 C-type lectin receptor signaling pathway
    107297118 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107297118 (RELA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107297118 (RELA)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    107297118 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pmur03000]
    107297118 (RELA)
Transcription factors [BR:pmur03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    107297118 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 107297118
NCBI-ProteinID: XP_029142061
LinkDB
Position
Unknown
AA seq 496 aa
MLEIIEQPKQRGMRFRYQCEGRLAGSIPGERSTDTTKTHPTIKIHNYQGPGKVRISLVTK
EAPHRPHPHDLVGKDCKEGYYEAELSPERSIHSFQNLGIQCVRKRDLEKAVTKRIETGNN
PFMPMEELKGDYDLNAVRLCFQVWIRDTGTGHLIQLPLVVSQPIYDNRAPNTAELKICRV
NRNSGTCLGGDEIFLLCDKVQKEDIEVRFFKDSWEAKGSFSQADVHRQVAIVFKTPPYAD
QAIREPVTVQMQLHRPSDKEVSGSMEFRYLPDEGDFHRIEEKRKRTLGTFKNFVQKTPFA
AMPAFLGASSQSPLRPIQKPQILAQPPAGFFVGSSHSTPPPPAAAASSFSTVNMEDLSCL
GVSPQAPPSSMDTESSIADAFLHLHFEGADPLGGLLDDAPYSSLDSINTTEFRQLLSEGA
GPMPQPGDHQATLLTYPESITRLVSQRRAGGEPGGDGGGPAGSTNNSFLNGLLGTLPAED
SFSSMVDLDLNSILNS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgctggagatcatcgagcagcccaaacagcggggcatgcgcttccgttaccagtgcgag
ggccgcttggctggctccatcccgggggaacgcagcaccgacaccaccaagacccacccc
accatcaagattcacaactaccagggtccggggaaggtccggatctccctggtgacgaag
gaagccccccatcggcctcatccccacgacctggtgggcaaggactgcaaagaaggctac
tacgaggccgagttgtctccggagcgctccattcacagcttccagaacctgggaatccag
tgcgtgcggaaacgggatctggaaaaggccgtgaccaagcggatcgagaccgggaacaac
ccgttcatgccgatggaggagctgaaaggagattacgacctgaatgcggtccgactctgc
ttccaggtctggattcgagatacgggcacggggcacttgattcagctgcccctggtggtc
tcccaaccaatctacgacaaccgtgcgcccaatacagccgagctgaaaatttgccgcgtg
aaccgcaattcggggacctgcctggggggagacgaaatcttccttctctgtgacaaagtg
cagaaagaggacatcgaagtccgctttttcaaggattcctgggaagccaaaggctccttc
tcgcaggccgacgtccaccgccaggtggccattgtcttcaagacgccgccctacgcggac
caggccatccgcgaacccgtgacggtccagatgcagctgcaccgtccctccgacaaggaa
gttagtggctccatggagttccgttatctcccggacgaaggcgatttccatcgaatcgag
gagaagcgtaaaaggacactgggcaccttcaagaactttgttcagaaaacaccttttgca
gccatgccagcctttctaggggcatcaagccagtcgcctctgcgcccgattcagaagcca
caaatcctggctcagcctcctgccggcttcttcgtcgggtccagccactccaccccgccg
cctccggcagccgccgcctccagcttcagcacggtcaacatggaggacctgtcgtgcctg
ggtgtctccccgcaggcgccgccctcctccatggacaccgaaagcagcatcgccgacgcc
ttcctgcacctccacttcgaaggcgcggatcccctggggggccttttggacgacgccccc
tacagcagcctggatagcatcaacaccaccgagttccggcagctgctcagcgaaggagcc
ggccccatgccgcagccgggggaccaccaggcgactctgctaacctacccagaatccatc
actcgcttggtcagccagcggagggcgggcggggagcccggcggggacggtggggggcct
gccggttcgaccaacaacagcttcctcaacggcctcttggggacccttcccgctgaggat
agcttttcgtccatggtcgacttggatttgaactcgattctcaactcgtaa

DBGET integrated database retrieval system