KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107298631
Entry
107298631         CDS       T05763                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04010  MAPK signaling pathway
pmur04020  Calcium signaling pathway
pmur04144  Endocytosis
pmur04510  Focal adhesion
pmur04540  Gap junction
pmur04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107298631 (PDGFRA)
   04020 Calcium signaling pathway
    107298631 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107298631 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107298631 (PDGFRA)
   04540 Gap junction
    107298631 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107298631 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmur01001]
    107298631 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pmur04090]
    107298631 (PDGFRA)
Enzymes [BR:pmur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107298631 (PDGFRA)
Protein kinases [BR:pmur01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107298631 (PDGFRA)
CD molecules [BR:pmur04090]
 Proteins
  107298631 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Herpes_gE
Other DBs
NCBI-GeneID: 107298631
NCBI-ProteinID: XP_015683494
LinkDB
Position
Unknown
AA seq 1085 aa
MGPSRKEFLVLGYLLAGSCIISCQSLLPAILPSEEQMVVQLDAPFTLKCSGDSEVSWQHP
APEGNHSITISNEENNSGLFVTVLEVANASASLTGLYICYYNHSQEEDGEVEGKEIYIFV
PDPAVPFVPTSPEDLFIVATEEDNSSIIPCRTTDPNTQVTLMNREGKILYASYDNRLGFI
GNFSLGSYICKTTVRAIEFESGEFFIYIYKAPSYLHVEIESPKTVYKTGETIIVTCVVLD
NEVVNLEWNYPGKVKNKGIISLDDIKVPTQKLIYNLTIPDASVKDSGDYECAVRHVTKDF
KKMERIAIYVHDKGFIQLEPQFKPAEAVNLHEVKNFVIYVYAYPEPRMFWLKDNVTLMEN
LTEIVTSSKQLKETRYQSVLKLIRAKEEDSGYYTLVAQNEDEIQRYTFSLLIQVPALIRD
LVDNHHGSVGQTVKCLAEGTPLPDVEWLVCKDIKKCNNDTSWTLLTNNISDVTVETHLDE
RNMVASQVTFQKVEEIMAVRCMAKNDLRTVTRELKLVAPTLRSELTVAAAVLVLLVIVII
ALIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKAKKDLDIFGMNSADESTRSY
VILSFENNGEYMDMKQAETTQYVPMLERKDKSKYSDIQRSLYDRPASYKKKSILDGKNLL
SDDNSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARD
IMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVD
STFYNKIKSGYRMTKPDHATSEMYDIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKKSY
DRIHLDFLKSDHPAVTRMRVDCDNPYIGVTYKNEDKMKDRESGFDEQRLSADSGYIIPLP
DIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFVKREDETVDDLDIIDDIGMDSSELV
EDSFL
NT seq 3258 nt   +upstreamnt  +downstreamnt
atgggtccttcccgaaaagaattcttggtcttgggctatctccttgcagggtcatgcatc
atctcctgccagagtttgcttcccgccattctcccaagtgaagagcaaatggtggtgcag
ctggatgcccccttcactttgaaatgttctggagacagcgaagtgagctggcagcatcca
gccccagagggcaaccactccatcaccatcagtaatgaagagaacaacagcggccttttc
gtgaccgtcctcgaagtggcgaacgcatcggcttccctcaccggattatacatttgttat
tataatcattctcaagaggaagatggagaagtcgaagggaaagagatctacatttttgtg
ccagatccagctgttccctttgttccaacctccccagaagatttgttcattgttgccact
gaggaggacaattcttccattatcccatgtcgcacgactgaccctaacactcaagtcact
ctaatgaacagagaaggaaaaattctgtatgcctcttacgacaacaggctgggcttcatt
ggaaacttctctttggggtcctatatatgcaagaccactgtcagagccatcgaattcgag
tctggcgaatttttcatctatatttacaaagctccatcataccttcatgttgaaattgag
tcccccaagactgtatataaaacaggagaaaccattattgttacttgtgtggtcttggat
aatgaagtggtgaacctagagtggaattatccagggaaagtgaagaataaaggaataatc
tcccttgacgacatcaaagttccaacccagaagctgatttataatttaaccattccagat
gcatcagtgaaggacagcggagattatgaatgtgctgttagacacgtgactaaagatttt
aagaaaatggaaaggattgccatctacgttcacgataaagggttcattcaattggagccc
cagttcaagccggcggaggccgtcaatctacacgaagtcaaaaactttgtcatttatgtc
tatgcgtatccagagccaaggatgttttggctgaaggacaacgtcacgctgatggagaat
ctcacagagattgtaaccagttccaagcaactcaaagaaaccagatatcagagtgtatta
aaattaattcgtgccaaggaagaagacagtggatattatacactcgtggcacagaatgag
gacgaaattcaaagatacactttctccctgctcatacaagttccagctttaattcgggac
ctggtagataatcaccacggctctgttgggcagacagtcaaatgtttggcagaagggaca
cccctccccgatgtggaatggctggtttgcaaggacattaagaaatgcaacaatgacacc
tcatggacactcctgaccaacaatatctctgacgttacggtggagactcatcttgatgag
aggaacatggtagccagccaggtgacatttcagaaggtggaagaaatcatggctgttcga
tgtatggctaagaatgaccttcgtactgttacaagggaactgaagcttgtggctcctaca
ttaagatcggaactcacagtggcggctgctgtcctcgtcctccttgtgattgtaataatc
gcgctgattgtcttggtaatcatatggaaacagaaacccagatatgagatcagatggaga
gtcattgagtcgatcagtcctgatggccacgaatacatctacgtggatcctatgcaattg
ccctatgactcaagatgggagtttcctagggatggattagtgctaggccgaatccttggt
tctggagcttttgggaaagtagtggaaggaaccgcatatggattaagccggtcacaacca
gtgatgaaagtagctgtgaaaatgttgaaaccaacggcaagatccagcgaaaagcaggct
cttatgtctgaattaaagataatgacccatcttggcccccacttgaacattgtcaacctt
ttaggagcctgcacaaaatcaggtccaatatacatcataacggaatactgtttttatgga
gacttggtgaactacctccataaaaatagggataattttctgagtcggcaccctgaaaag
gcgaagaaggatctggacatttttggcatgaattctgcagatgaaagcacgagaagctat
gtcatcctgtcctttgaaaacaatggtgaatatatggatatgaaacaagcagagacaact
cagtatgtgcccatgttagaaagaaaagacaagtcgaaatactctgacatccaaagatct
ttgtatgatcggcctgcttcatataagaaaaaatctatattggatgggaagaatctgctt
tctgatgataattcagaaggcctcagtttgttggatcttctgagcttcacctaccaagta
gctcggggaatggagttcctggcttcaaaaaactgcgtgcaccgtgatctggcagcacga
aatgtcctcttggctcaagggaaaattgtgaagatctgtgactttgggctagcaagagat
atcatgcacgattcaaactatgtctccaaaggcagtaccttccttccggtgaagtggatg
gcacctgaaagcatttttgacaacctgtataccacattaagtgatgtctggtcctatggc
attctgttatgggaaatattttctcttggtgggaccccataccctggcatgatggttgac
tctaccttctataataaaataaaaagtggctatcggatgacaaaaccagatcatgctacc
tctgagatgtatgacatcatggtgaaatgctggaatagtgaacctgaaaagagaccatct
ttttatcacttaagtgaaatagtggagagtctgttgcctggtgaatacaagaagagttat
gatagaatccacttggacttcttaaagagtgatcatcctgccgtcacacgcatgagagtg
gactgtgacaatccatatattggtgtcacttacaagaacgaggacaagatgaaagacagg
gagagtggatttgatgaacagagactcagtgcagacagtggctatataatcccactgcct
gatattgaccctgtatcagaagacgaactggggaaaaggaatagacacagttctcagacc
tctgaggaaagcgccatcgaaaccggatccagcagttctacgttcgtgaagcgagaagac
gaaaccgtggatgaccttgacattatcgatgacattggcatggattcctcagaactagtt
gaggacagcttcctgtaa

DBGET integrated database retrieval system