KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107298665Help
Entry
107298665         CDS       T05763                                 

Definition
(RefSeq) WD repeat and HMG-box DNA-binding protein 1
  KO
K11274  chromosome transmission fidelity protein 4
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pmur03036]
    107298665
Chromosome and associated proteins [BR:pmur03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    107298665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box
Motif
Other DBs
NCBI-GeneID: 107298665
NCBI-ProteinID: XP_015683527
LinkDB All DBs
Position
Unknown
AA seq 358 aa AA seqDB search
CTLEREFRCMELAELMTQNATSLAIKYASRSRRLILAQKLSEFAAEKVSEPASTEEYAEQ
EEEEEEKQQPPDFRNHLNAGYSNSPTEWSRARERNIQRQQNMETCEEDESKVNTANEAKS
SSPTLHGHASISKSAVLASSNSIRANPFKVSSSQKDAFIHSPNILDNLIRLPKKNPTMNG
QGAPNKKSPIIKPLMPKPKSKQSAATAFFQPRALTTEKKVREEREDKNDTVAPELQSVTD
NKDNKRPKTGFQIWLEENRSSILSDNPHFEETEIIKEGMVRYRILSAEERMVWTEKAKGR
ETSDPSEGKKRKRPEDVNNKKQESQEQNSEEDVGSAKKSKSFNQSTFAKLSTFAYKQK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
tgcacactggaacgtgaatttcgctgcatggagcttgctgaactcatgacacaaaatgcc
acgagcttagctatcaaatacgcctctcgctcacggaggctgattcttgcccagaagctc
agtgaatttgctgcggagaaggtctcagagccggcatctactgaagagtacgccgagcaa
gaagaggaagaagaagagaagcagcagccgccggattttagaaaccacctgaatgctggg
tatagtaatagccccacagagtggagtcgtgcccgagagagaaacattcaacgccagcaa
aatatggagacctgtgaagaggatgagtcgaaagtgaacaccgctaatgaggcaaaatct
agctctcccacgctgcatggacatgcatctatttcgaagtctgctgtccttgcatctagc
aactcaataagagcaaatccttttaaggtatccagtagccaaaaagatgcatttattcac
tcacccaatattctggataacctgatcaggctgcctaagaaaaatcccacgatgaatggt
caaggagctccaaacaagaagagtccaattatcaaaccgttgatgcccaagcccaagtca
aagcagtctgcagcaactgcctttttccaaccccgagcacttactactgaaaagaaagtc
agagaagagagagaggacaaaaatgacacggtagcccctgaacttcaaagtgtgactgac
aacaaagacaataaaaggccaaagactggattccagatatggctagaagagaacagaagc
agtattttatcagataatccccattttgaagaaacagaaataataaaagaaggcatggtt
cgatacagaattctctctgctgaggaaaggatggtgtggactgagaaagccaaaggaaga
gaaaccagtgatccatctgaaggtaaaaagcgaaagcgcccagaggatgttaacaataaa
aagcaagaaagccaagaacaaaactcagaagaggatgtgggctctgctaaaaaatccaaa
tcatttaatcagtctacctttgcaaaactgtcaacatttgcatataagcagaagtaa

DBGET integrated database retrieval system