KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107300936Help
Entry
107300936         CDS       T05763                                 

Definition
(RefSeq) cyclin-H-like
  KO
K06634  cyclin H
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03022  Basal transcription factors
pmur03420  Nucleotide excision repair
pmur04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    107300936
  09124 Replication and repair
   03420 Nucleotide excision repair
    107300936
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107300936
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pmur03021]
    107300936
   03400 DNA repair and recombination proteins [BR:pmur03400]
    107300936
Transcription machinery [BR:pmur03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     107300936
DNA repair and recombination proteins [BR:pmur03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     107300936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 107300936
NCBI-ProteinID: XP_015685702
LinkDB All DBs
Position
Unknown
AA seq 253 aa AA seqDB search
MYHSSTQRRYWTFRGEEELSRRRSDANRKFRCKAVANGKVQQTDSFLLDQHEELIICKYY
EKRLADFCSVFKPAMPKSVGGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSAQFVGNLRESPAGQEKTLEQILEYELLLIQQLNFHLIVHNPYRPFEGLLIDLKTRYQL
LENPETLRKTADDFLNRVSLTDACLLFTPSQIALTAMVSSASRSGFNMESYLSGTLMLKE
NKTSLSQLLDGMK
NT seq 760 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacagcagcacgcagaggcgctactggactttccgcggcgaggaggaattgtcc
cgcaggcgctctgacgccaaccgcaagttcagatgcaaagcggtggccaatgggaaggtt
caacagacagactcatttcttcttgaccaacatgaagagctgataatttgtaaatattat
gaaaaaagattagcagacttttgctctgtatttaaaccagcaatgcccaaatctgttggg
ggtacagcatgcatgtatttcaaacgtttttacctcaataactcagtaatggaatatcat
ccccggataattatgttaacgtgtgcattcttggcttgtaaagtagatgaatttaatgta
tctagtgcacaatttgttggtaaccttcgtgagagcccagcaggacaggagaagacattg
gaacagatcttggaatatgaattactacttattcagcagctgaatttccaccttatagta
cataacccttacagaccatttgaagggctattgattgatttgaagacccgttatcaattg
cttgaaaatcctgagacattgaggaaaacagcagatgattttcttaatcgggtatctttg
acagatgcctgccttctatttacaccttctcagatagctcttaccgctatggtatcaagt
gcatccaggtcaggatttaatatggaaagttacttatcaggaaccctgatgctcaaagag
aataaaacatccctttcacagttgctggatggaatgaaat

KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107302941Help
Entry
107302941         CDS       T05763                                 

Gene name
CCNH
Definition
(RefSeq) cyclin-H isoform X1
  KO
K06634  cyclin H
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur03022  Basal transcription factors
pmur03420  Nucleotide excision repair
pmur04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    107302941 (CCNH)
  09124 Replication and repair
   03420 Nucleotide excision repair
    107302941 (CCNH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107302941 (CCNH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pmur03021]
    107302941 (CCNH)
   03400 DNA repair and recombination proteins [BR:pmur03400]
    107302941 (CCNH)
Transcription machinery [BR:pmur03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     107302941 (CCNH)
DNA repair and recombination proteins [BR:pmur03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     107302941 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N UBA2_C Cyclin_C
Motif
Other DBs
NCBI-GeneID: 107302941
NCBI-ProteinID: XP_015687590
LinkDB All DBs
Position
Unknown
AA seq 322 aa AA seqDB search
MYHSSTQRRYWTFRGEEELSRRRSDANRKFRCKAVANGKVQQTDSFLLDQHEELIICKYY
EKRLADFCSVFKPAMPKSVGGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSAQFVGNLRESPAGQEKTLEQILEYELLLIQQLNFHLIVHNPYRPFEGLLIDLKTRYQL
LENPETLRKTADDFLNRVSLTDACLLFTPSQIALTAMVSSASRSGFNMESYLSGTLMLKE
NKTSLSQLLDGMKLGMKNLVKKYELPHPEEVAVLKQKLEKCHSSELALNTNTKKRKGYEG
DEFISKKSRMEEDEWTDDDFMD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacagcagcacgcagaggcgctactggactttccgcggcgaggaggaattgtcc
cgcaggcgctctgacgccaaccgcaagttcagatgcaaagcggtggccaatgggaaggtt
caacagacagactcatttcttcttgaccaacatgaagagctgataatttgtaaatattat
gaaaaaagattagcagacttttgctctgtatttaaaccagcaatgcccaaatctgttggg
ggtacagcatgcatgtatttcaaacgtttttacctcaataactcagtaatggaatatcat
ccccggataattatgttaacgtgtgcattcttggcttgtaaagtagatgaatttaatgta
tctagtgcacaatttgttggtaaccttcgtgagagcccagcaggacaggagaagacattg
gaacagatcttggaatatgaattactacttattcagcagctgaatttccaccttatagta
cataacccttacagaccatttgaagggctattgattgatttgaagacccgttatcaattg
cttgaaaatcctgagacattgaggaagacagcagatgattttcttaatcgggtatctttg
acagatgcctgccttctatttacaccttctcagatagctcttaccgctatggtatcaagt
gcatccaggtcaggatttaatatggaaagttacttatcaggaaccctgatgctcaaagag
aataaaacatccctttcgcagttgctggatggaatgaaattaggcatgaaaaatctggta
aaaaaatatgagctaccacatcctgaagaggttgctgttttaaaacagaagttagaaaaa
tgtcacagttcagaacttgctcttaatacaaatacgaaaaagagaaaaggctatgaaggt
gatgaattcatctcaaaaaagtctagaatggaggaggatgaatggacagatgatgatttc
atggactga

DBGET integrated database retrieval system