KEGG   Protobothrops mucrosquamatus (Taiwan habu): 107301319
Entry
107301319         CDS       T05763                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
pmur  Protobothrops mucrosquamatus (Taiwan habu)
Pathway
pmur04010  MAPK signaling pathway
pmur04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pmur00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107301319 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107301319 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pmur04052]
    107301319 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:pmur00536]
    107301319 (FGF1)
Cytokines and growth factors [BR:pmur04052]
 Growth factors
  Growth factors (RTK binding)
   107301319 (FGF1)
Glycosaminoglycan binding proteins [BR:pmur00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107301319 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107301319
NCBI-ProteinID: XP_015686049
LinkDB
Position
Unknown
AA seq 148 aa
TFTAMTEKFDLPMADYNQPKLLYCSNGGQFLRILPDGKVDGTRDRNDNHIQLLLSTEYFG
AVYIKGIGSGLYLAMDVNGRLHGSQLPTAECVFLEKLEENNYNTYKSKMHADKNWYVALK
KNGNSKLGPKTTYGQNAILFLPLPVSPD
NT seq 447 nt   +upstreamnt  +downstreamnt
acatttactgccatgacagaaaaatttgatctgccaatggctgattacaaccagcccaag
cttctttattgcagcaacggaggtcagttcctgagaatccttccagatggcaaagtggat
ggcacaagggaccggaacgacaatcacattcagttactgctcagcacagaatattttggt
gctgtgtacataaaaggcattggatctggactatacttggctatggatgtcaatggacgc
ttacatggctcgcagttgccaacagcagagtgtgtgttcctggaaaagttggaagaaaac
aattacaatacttacaagtcaaagatgcatgcagataagaactggtatgttgccttgaag
aagaatggaaacagcaaattgggaccgaagactacctatggccagaatgcaattcttttc
cttcctctgccagtgtcacctgattag

DBGET integrated database retrieval system