KEGG   Paracoccus mutanolyticus: DPM13_02120Help
Entry
DPM13_02120       CDS       T05551                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pmut  Paracoccus mutanolyticus
Brite
KEGG Orthology (KO) [BR:pmut00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DPM13_02120
Enzymes [BR:pmut01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DPM13_02120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like DAO FAD_binding_2 AlaDh_PNT_C NAD_binding_7 FAD_binding_3 NAD_binding_9 NAD_binding_8 K_oxygenase Thi4 Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AWX92440
UniProt: A0A2Z4PA29
LinkDB All DBs
Position
353205..354770
Genome map
AA seq 521 aa AA seqDB search
MLDQNMKTQLKAYLTRLVRQVEITTFAGDDAKSREMLALVEDIRSLSDKITVVDGGTGTR
TPSFSLTSPGQDIHLTFAGLPMGHEFTSLVLALLQVGGHPPKVEQAVIDQIRGLEGPFRF
ETYFSLSCQNCPDVVQALNLMAVLNPGIEHVAIDGALFPAEVEARQVMSVPTVFLNGEMF
GAGRMDAEQILAKLDTGAADRAALAIGKEAPYDVLVIGGGPAGAAAAVYAARKGIRTGVV
AERFGGQVLDTMSIENLISVPRTEGPQLARALENHVREYDVRIFNAQTATGLQEVDGGYR
VTLASGATLTSAAVVLSTGARWRRMEVPGEGQYLNKGVTFCPHCDGPLFKGKRVAVIGGG
NSGAEAAIDLAGLVAHVTLIEFDSRLRADEVLQRKLRSLPNVTILTEARTTEVKGDGRRV
TGLAYEDRRSGKIREIALEGIFVQIGLIPNTDWLKGVLTLSPRGEIVVDEHGATSLPGVF
AAGDCTTAPYKQIVIAMGEGARASLAAFDHLIRLPLAEKAA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaccagaatatgaaaacccagctcaaggcctatctcacccgccttgtccgtcag
gtcgagatcaccacctttgcgggcgatgacgccaagtcgcgcgagatgctggcactggtc
gaggatatccgcagcctgtccgacaagatcaccgttgtcgacggcggcacaggaacgcgc
accccgtccttttcgctgacctcgcccggccaggacatccacctgaccttcgccgggctg
ccgatgggtcatgaattcacctctttggtgctggcgctgctgcaggtcgggggacatccg
cccaaggtcgaacaggcggtgatagaccagatccggggactggagggcccgttccggttc
gagacctatttctcgctgtcgtgccagaactgccccgatgtggtgcaggcgctgaacctg
atggcggtgctgaaccccggcatcgagcatgtcgccatcgacggcgcgctgtttccggcc
gaggtcgaggcgcggcaggtgatgtcggtgccgacagtctttctcaacggcgagatgttc
ggggccggcaggatggatgccgaacagattctcgccaagcttgataccggggcggcggac
cgtgcggccttggccatcggcaaggaggccccctatgacgtgctggtgatcggcggcggg
cctgccggagcggcggcggcggtctatgccgcgcgcaagggcatccgcaccggcgtggtg
gccgaacgcttcggcggccaggtgcttgacaccatgtctatcgagaacctgatctcggtg
ccccgcaccgagggccctcaactggcccgcgcgttggaaaaccacgtgcgcgaatatgat
gtgaggatcttcaacgcccagaccgccaccggcctgcaagaggtcgacggcggatatcgg
gtcaccctggcctctggcgcgacgctgacctcggcggcggtggtgctgtcgaccggcgcg
cgctggcggcggatggaggtgccgggcgaagggcaatatctgaacaagggcgtgactttc
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtgatcggtggcggc
aattccggggccgaggcggcgattgatctggccgggctggtcgcccatgtcacgctgatc
gaattcgactcccggctgcgcgccgatgaggtgctgcagcgcaagctccgcagtctgcca
aacgtcaccatcctgaccgaggcccgcacgaccgaggtgaagggggatggccgcagggtc
acgggccttgcctatgaggaccgccgcagcggcaagatccgcgagatcgcgctggagggc
atcttcgtgcagatcggcctgatcccgaataccgactggctgaaaggagtgctgaccctc
agcccgcgcggcgagatcgttgtggacgagcacggcgcgacctcgctgcccggcgtcttc
gccgccggcgactgcaccacagccccctacaagcagatcgtcatcgcgatgggcgagggt
gcacgggcaagtcttgccgccttcgaccatctgatccgcctgccgctggccgaaaaggcg
gcctga

DBGET integrated database retrieval system