KEGG   Paracoccus mutanolyticus: DPM13_02815Help
Entry
DPM13_02815       CDS       T05551                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pmut  Paracoccus mutanolyticus
Pathway
pmut00071  Fatty acid degradation
pmut00280  Valine, leucine and isoleucine degradation
pmut00281  Geraniol degradation
pmut00310  Lysine degradation
pmut00362  Benzoate degradation
pmut00380  Tryptophan metabolism
pmut00410  beta-Alanine metabolism
pmut00640  Propanoate metabolism
pmut00650  Butanoate metabolism
pmut00903  Limonene and pinene degradation
pmut00930  Caprolactam degradation
pmut01100  Metabolic pathways
pmut01110  Biosynthesis of secondary metabolites
pmut01120  Microbial metabolism in diverse environments
pmut01130  Biosynthesis of antibiotics
pmut01200  Carbon metabolism
pmut01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pmut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DPM13_02815
   00650 Butanoate metabolism
    DPM13_02815
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DPM13_02815
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DPM13_02815
   00310 Lysine degradation
    DPM13_02815
   00380 Tryptophan metabolism
    DPM13_02815
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DPM13_02815
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DPM13_02815
   00281 Geraniol degradation
    DPM13_02815
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DPM13_02815
   00930 Caprolactam degradation
    DPM13_02815
Enzymes [BR:pmut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     DPM13_02815
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     DPM13_02815
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     DPM13_02815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_8 DAO DFP MotA_ExbB NAD_binding_2 2-Hacid_dh_C UDPG_MGDP_dh_N FAD_binding_3 NAD_Gly3P_dh_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AWX92521
UniProt: A0A2Z4PAD9
LinkDB All DBs
Position
493291..495474
Genome map
AA seq 727 aa AA seqDB search
MTDFTMQKDAEGVAIITWDVPGKSMNVLSLDGAAELDALIDEALADDAVKGIVITSGKKD
FAAGMDLNVIAAMKDGGAQAVFDGIMGLHHALRKIELAGMDPKTKTGGKPIASALPGTAL
GIGLELPLATHRIFAAENPKAKIGLPEIMVGIFPGGGGTTRLVRKLGAMGSAPFLLEGKL
SDPARAKAAGLIDEVAADPVAAARAWVLQAGDADLVKPWDAKGYKMPGGEPYHPAGFMTF
LGASAMVHGKTLGVYPAAKALLSAVYEGAMVPFDTALKIEARWFTNVLMNPSSTAMIRSL
FINKEALEKGANRPEAPDQRVRKLGILGAGMMGAGIAYVSAMAGIEVVLIDAAQDAADRG
KAHSADLLDKAVSRRKATEEKKAEVLARITATTDYAALAGCDLVVEAVFEDPKIKAEVTA
RAEAAISADAIFATNTSTLPISDLARASSRPDQFVGIHFFSPVDKMALVEIIKGKRTGPR
AVAKALDFVRQIRKTPIVVNDARFFYANRCIIPYINEGIRMVAEGVSPTLVENAAKLMGM
PLGPLQLVDETSIDLGVKIAKATRAALGDAYPDDAVDAVIFRLADQGRLGRKAKAGFYDY
DEGAKRQGLWPGLATEWPEADQQPDLTELQHRLMFAQSLEAVRALQDGVLEDIREGDVGA
ILGWGFAPWTGGPFGWLDMLGAARAVEIAEGLARKFGPRFAAPQLLKDMAAKGESFYGRV
STGKQAA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacttcaccatgcagaaggacgccgagggcgtcgccatcatcacctgggatgtg
ccgggcaagtcgatgaacgtgctgtcgctcgacggcgcggcggaactcgatgcgctgatc
gacgaggcgcttgcggacgatgcggtcaagggcatcgtcatcacctcgggcaagaaggac
tttgccgccggcatggacctgaacgtgatcgccgcgatgaaggacggcggcgcgcaggcg
gtgttcgacggcatcatggggctgcaccacgcgctgcgcaagatcgagctggccggcatg
gaccccaagaccaagacgggcggcaagcccatcgcctcggccctgcccggcacggcgctg
gggatcgggctggagctgccgctggccacgcatcgcatctttgccgccgagaatcccaag
gccaagatcgggctgcccgagatcatggtcggcatctttcccggcggcggcggcaccacc
cgactggtgcgcaaactgggcgcgatgggctcggcgcccttcctgctggaaggcaagctg
agcgacccggccagggccaaggcggcgggcctgatcgacgaggtcgcggccgacccggtc
gccgccgcgcgcgcatgggtgctgcaagccggcgacgccgatctggtgaagccctgggac
gccaagggctacaagatgccgggcggcgaaccctatcacccggcgggcttcatgaccttc
cttggcgccagcgccatggtgcatggcaagacgctgggcgtctatccggcggccaaggcc
ctgctttcggcggtctatgaaggcgccatggtgcccttcgacaccgcgctgaagatcgag
gcgcgctggttcacgaacgtgctgatgaacccctcgagcacggcgatgatccggagcctg
ttcatcaacaaggaggcgctggagaaaggcgcgaaccgtcccgaggcgcccgaccagagg
gtcaggaagctgggcatcctcggcgccggcatgatgggggcgggcatcgcctatgtctcg
gccatggccgggatcgaggtcgtgctgatcgacgccgcccaggacgccgccgaccggggc
aaggcccattcggccgacctgctggacaaggcggtcagccgccgcaaggcgaccgaggag
aaaaaggccgaggtcctggcccgcatcaccgcgacgaccgattacgccgcgctggccggc
tgcgacctggtggtcgaggccgtgttcgaggacccgaagatcaaggccgaggtgaccgcc
agggccgaggcggcgatctccgccgacgcgatcttcgccaccaacacctcgaccctgccg
atcagcgacctggcccgcgccagcagccgcccggaccagttcgtcggcatccacttcttc
tcgcccgtcgacaagatggccctggtcgagatcatcaagggaaaacggaccggcccccgc
gccgtcgccaaggcgctcgacttcgtgcgccagatccgcaagacgcccatcgtggtcaat
gacgcgcggttcttctacgccaaccgctgcatcatcccctatatcaacgaaggcatccgc
atggtggccgagggcgtcagccccaccctggtcgagaatgccgccaagctgatgggcatg
ccgctggggccgctgcagctggtggacgaaacctcgatcgacctcggcgtcaagatcgcc
aaggcaacccgcgccgccctaggcgatgcctaccccgacgatgcggtggacgcggtgatc
ttcaggctggccgaccagggccggctgggccgcaaggccaaggccggcttctacgactat
gacgagggggccaagcgccagggcctctggccgggtcttgccaccgaatggcccgaagcc
gaccagcagcccgacctgaccgagcttcagcaccgcctgatgttcgcccagtcgctcgag
gcggtccgggccctgcaggacggcgtactcgaggacatccgcgaaggcgatgtcggcgcc
atcctgggctggggcttcgcgccctggaccggcggcccctttggctggctcgacatgctg
ggcgccgcgcgcgccgtcgagatcgccgaagggctggcgcgcaaattcggtccccgcttc
gccgcgccgcaactgctcaaggacatggcggccaagggcgaaagcttctatggccgcgtc
agtaccggcaagcaggccgcctga

DBGET integrated database retrieval system