KEGG   Paracoccus mutanolyticus: DPM13_04055Help
Entry
DPM13_04055       CDS       T05551                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pmut  Paracoccus mutanolyticus
Pathway
pmut00240  Pyrimidine metabolism
pmut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmut00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    DPM13_04055
Enzymes [BR:pmut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     DPM13_04055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 TruB_C
Motif
Other DBs
NCBI-ProteinID: AWX92649
UniProt: A0A2Z4PB09
LinkDB All DBs
Position
722096..722674
Genome map
AA seq 192 aa AA seqDB search
MAMLYFHYSTMNAGKSTMLLQASHNYRERGMRTLLLTAALDDRAGPGLIASRIGIAEPAM
TFAPDTDLFALVRDRGAGCACVLLDEAQFLSQAQVWQLARVVDDLDLPVMCYGLRVDFRG
QPFPGSAALLAWADELREVRTVCHCGRRATMVIRRDEQGRALRDGAQVQVGGNETYVSLC
RRHWREAMGEIR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggccatgctttattttcattattccacgatgaacgcgggcaaaagcacgatgcttttg
caggcctcgcacaattatcgcgaacgcggcatgcgcacgctgctgctgacggctgcgctg
gacgaccgcgccggaccgggcctgatcgccagccgcatcggcatcgccgaacccgccatg
acctttgcccccgacaccgatctgttcgccctggtccgcgaccggggcgcgggctgcgcc
tgcgtccttctggacgaggcccagttcctcagccaggcacaggtctggcaactcgcccgc
gtcgtcgacgaccttgacctgccggtgatgtgctatggcctgcgcgtcgatttccggggc
cagccgtttcccggctcggcggcgctgctggcctgggcggacgagctgcgcgaggtgcgc
accgtctgccattgcggccgccgcgccaccatggtcatccgccgggacgaacagggccgg
gcgctgcgcgacggcgcgcaggtccaggtcggcggcaatgaaacctatgtctcgctctgc
cgccgccattggcgcgaagcgatgggagaaatccgatga

DBGET integrated database retrieval system