KEGG   Paracoccus mutanolyticus: DPM13_13750Help
Entry
DPM13_13750       CDS       T05551                                 

Definition
(GenBank) NADH-specific enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pmut  Paracoccus mutanolyticus
Pathway
pmut00061  Fatty acid biosynthesis
pmut00780  Biotin metabolism
pmut01100  Metabolic pathways
pmut01130  Biosynthesis of antibiotics
pmut01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pmut00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DPM13_13750
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DPM13_13750
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DPM13_13750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pmut01004]
    DPM13_13750
Enzymes [BR:pmut01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DPM13_13750
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DPM13_13750
Lipid biosynthesis proteins [BR:pmut01004]
 Fatty acid synthase
  Component type
   DPM13_13750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AWX93745
UniProt: A0A2Z4PDS8
LinkDB All DBs
Position
complement(2539506..2540294)
Genome map
AA seq 262 aa AA seqDB search
MTGLMQGKRGLVMGVANDRSIAWGIAKALADQGAELAFSYQGEAFGKRVEPLAASLGSDF
LLDVDVTDDASLDAAFGRIGERWGKLDFVVHAIAFSDKNELTGRFINTTRENFRNSLTIS
CYSLIDVARRARPLMTDGGTILTLTYAGSNRVTPFYNVMGVAKAALESAVRYLANDLGPE
GIRVNAISPGPMKTLAGAAIGGARKTYRHTEANAPLRANATLEAIGGTAVWLCSDWGAYT
TGETVLVDGGYHVLGMPQSENL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtttgatgcaaggcaagcgcggtctggtcatgggggtcgcgaacgaccgctcc
attgcctggggtatcgcgaaggcgctggcggaccagggggcggaactggcgttttcctat
cagggtgaggcgttcggcaagcgggtcgagccgttggcggcaagcttggggtcggatttc
ctgctggacgtggacgtgaccgacgacgcctcgctggacgcggccttcggccggatcggt
gaacgctggggcaagctggatttcgtcgtccatgccatcgcgttttcggacaagaacgaa
ctgaccgggcggttcatcaacaccacgcgcgagaatttcaggaactcgctgacgatttcc
tgctattcgctgatcgacgtggcgcgccgggcgcggccgctgatgacggatggcggcacg
atcctgacgctgacctatgccggctcgaaccgggtgacgcctttctacaacgtcatgggc
gtggccaaggcggcgctggaatcggcggtgcgctatctggccaacgaccttggccccgaa
ggcatccgcgtgaacgcgatcagccccggtccgatgaagacgctggccggcgcggccatc
ggcggcgcgcgcaagacctatcgccacaccgaggcgaacgcgccgctgcgcgccaacgcc
acgctcgaggcgatcggcggcaccgcggtctggctgtgtagcgactggggcgcctacacc
accggcgaaaccgtgctggtcgatggcggctatcacgtgctgggcatgccgcagtcggaa
aacctgtga

DBGET integrated database retrieval system