KEGG   Paracoccus mutanolyticus: DPM13_13760Help
Entry
DPM13_13760       CDS       T05551                                 

Definition
(GenBank) bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
pmut  Paracoccus mutanolyticus
Pathway
pmut00061  Fatty acid biosynthesis
pmut01100  Metabolic pathways
pmut01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pmut00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DPM13_13760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pmut01004]
    DPM13_13760
Enzymes [BR:pmut01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     DPM13_13760
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     DPM13_13760
Lipid biosynthesis proteins [BR:pmut01004]
 Fatty acid synthase
  Component type
   DPM13_13760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA DUF5608
Motif
Other DBs
NCBI-ProteinID: AWX94504
UniProt: A0A2Z4PFK3
LinkDB All DBs
Position
complement(2541573..2542082)
Genome map
AA seq 169 aa AA seqDB search
MTITRTSFDKDDLLACARGELFGPGNAQLPEPPMLMMDRITDISADGGAHGKGHVVAEFD
ITPDLWFFACHFPGNPIMPGCLGLDGLWQLTGFNLGWRGWQGRGYALGVGEVKLTGMVRP
DRKLLRYHVDFTKAVQTRRLTMGVADGRVEADGEVIYLVKDMKVALSES
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcacccggaccagctttgacaaggacgatctgctggcctgcgcccgtggcgaa
ctgttcggccccggcaatgcgcaactgcccgagccgccgatgctgatgatggaccgcatc
accgacatttcggccgatggcggggcccatggcaagggccatgtggtcgcggaattcgac
atcaccccggacctgtggttctttgcctgccatttccccggcaacccgatcatgccgggc
tgcctgggcctggacgggctgtggcagctgaccggcttcaacctgggctggcgcggctgg
caggggcgcggctatgccctgggcgtcggcgaggtcaagctgaccggcatggtccgcccg
gatcgcaaactgctgcgatatcatgtagacttcaccaaggccgtgcagacacgccgcctg
accatgggcgtggcggatggccgcgtcgaggccgatggcgaggtcatctatctggtcaag
gacatgaaggtcgcgctgtcggaaagctga

DBGET integrated database retrieval system