KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0722Help
Entry
PMCN06_0722       CDS       T01776                                 

Gene name
nanH
Definition
(GenBank) sialidase NanH
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
pmv00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:pmv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    PMCN06_0722 (nanH)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PMCN06_0722 (nanH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:pmv02042]
    PMCN06_0722 (nanH)
Enzymes [BR:pmv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     PMCN06_0722 (nanH)
Bacterial toxins [BR:pmv02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   PMCN06_0722 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_3 BNR_2 BNR GA
Motif
Other DBs
NCBI-ProteinID: AFF23972
LinkDB All DBs
Position
complement(772632..775040)
Genome map
AA seq 802 aa AA seqDB search
MKKPVFLLSLLALSTSMAVHGNSFWKADLHENLTNVTKRAGVDGFTVNKEGQPWPGIGPN
GEAGGTVTLPYSRIPAMTITDDNKMVVMFDLRWKTASDQNRIDPGAAISEDGGHSWKRIT
AWNFNDSKISLRRAMDPTLLYNSIDGSLYVMHGTWAAGTSNWYQDRRNYFNQNIWAATIY
KSTDGGLSWQKNTEFSNTVNRDVFMKVKKGASNSTIGFLGGVGTGIVMKDGTLVFPIQTA
HYNGIATTIMYSKDNGKTWDMPETDNALAPNQSSLENMVFEIDNKLVMTGREENNRDANK
RTRWAYYTEDLGKTWHVYEPVNGFSATTAAPSQGSSIYVTLPSGKRVLLVSKPNGNGNDG
YARGNLALWMLDAKNPDHKHEVAIIRSGSGNKAGAGYSSLAYKEGNLFIAFEDDGDITVK
NLSEHMQAIEEKATEWGLTDEIATEVEKINSLEHLNKGQKETLSAKMRRTNDNAVAESNV
LNREMHELKDEATSLEQKSVAMRKALPSKLKQFKRDLGEVRDLTQLTNETYLNYLGIQGL
MAMLNGSFLALNTPLDFSKYIKRGEKLNSYDTDILYSTYNKVFVEYDSVIKNSQHRPTIA
LGLNTRLTDQTQAGVFYEHENKKQKVDAFGVRAQYTKGDNVLAAFLRYRTVKHDDVIDRN
HNVDLYINYAKNVNIDSHLTLSPFVGAYTSLSSRTLLDEDVAVNKRLVMAGDVGLDIRYR
LADISVSIRPNIAFIKDGFTLSQANYQDNQYKIKSTNMVYALNVGVEKQFTPHLALGSKM
KLQKYGSQASEVSLGVNLSYHW
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagccggtgttcttgttgtctttactcgcactctctacttcaatggcagtacat
ggtaacagcttttggaaagctgatttgcatgaaaatttaactaatgtgacgaaaagggca
ggcgttgatggttttactgtaaataaagaaggtcaaccttggccagggataggaccgaat
ggcgaagcgggtggaacagttacactaccttatagccgtattccagctatgacgattaca
gatgataataaaatggttgtgatgtttgatttacggtggaagacagcaagtgaccaaaat
cgtatcgatcctggcgccgcgatttcagaagatggggggcatagttggaaaagaattacc
gcttggaattttaatgattcaaaaatttctttgcgtcgtgcgatggacccgacattattg
tacaacagcattgatggcagtttatatgtgatgcacggcacttgggcggcaggaacaagc
aactggtatcaagatagaagaaactactttaatcagaatatttgggcggcaacaatttat
aaatccactgatggtggattaagttggcaaaaaaatactgaattcagcaatactgtgaat
cgcgatgtttttatgaaagtaaaaaaaggggcaagcaattcaacaattggatttttaggc
ggtgtgggaacgggaattgtgatgaaagacggtacattagttttcccaatccaaacagcg
cactataacggtattgccacgacaattatgtattcgaaagataatgggaaaacctgggac
atgccggaaactgacaatgcgttagctccaaaccaaagttctttagaaaatatggtattc
gaaattgataataagttagtgatgacaggacgagaagaaaataatcgtgatgccaataaa
agaacaagatgggcttattacactgaagatttaggaaaaacttggcatgtttatgaacca
gttaatggctttagtgcgactacagcagctccttcacaaggttcatcgatttatgtaacc
ttaccgagtggaaagcgtgttttattggtgtcaaaaccaaatggtaatggtaatgatggc
tatgcaagaggaaatttggcactttggatgctagacgctaaaaatccagatcataaacat
gaagtggcaattattagatctggttcaggtaataaagccggtgctggatattcttcttta
gcctataaagaaggtaatttatttattgcctttgaagacgatggtgatattaccgttaaa
aatcttagcgaacatatgcaagcgattgaagaaaaagccacagaatggggtttaaccgat
gaaattgcaacagaagtggagaaaatcaattcgttagaacatttaaataaaggacaaaaa
gagacactaagcgccaaaatgcgccgaacgaatgataatgcggtggctgaatcgaacgtc
ttaaatcgagaaatgcatgaattaaaagacgaagcaacatcacttgagcaaaaatcggtg
gcgatgagaaaagcactaccctctaaactgaaacagtttaagcgagatcttggagaagtg
cgtgatttaacacaactgaccaatgaaacctaccttaattatcttggtatacaagggtta
atggctatgttaaatgggtcttttcttgcgctcaatacgccattagatttttctaagtac
ataaaacgaggtgaaaagctcaatagctatgacacggatattctttatagtacctataat
aaggtgtttgttgagtacgattcagtgattaaaaacagccaacaccgtccgacaattgcg
cttggattaaatacaaggttaactgaccaaacacaagcgggagtgttttatgagcatgaa
aataaaaaacaaaaagtcgatgcctttggggtaagagcgcaatacacaaaaggggataat
gtgttagcggcctttttacgttatcgaactgttaaacatgatgacgtgattgatcggaac
cataatgttgatctgtacatcaattatgcgaaaaacgtgaatattgattcgcatttgaca
ttaagtccatttgttggtgcttatacatcgctctcttcacgtacgttgttggatgaagat
gtcgcagtgaataaacgtcttgtgatggcaggtgatgtagggcttgacattcgttatcgt
ttagcggatatcagtgtgagtattcgaccgaatattgcttttatcaaagatggtttcact
ttatcacaagcaaattatcaggataaccaatataaaataaaatccactaacatggtttat
gctttaaatgtgggggttgagaaacaattcacgccccaccttgcgctaggttcaaaaatg
aagctacaaaaatatggctcacaagcatcagaagtgagtttaggcgtaaatttaagttat
cattggtaa

DBGET integrated database retrieval system