KEGG   Paenibacillus mucilaginosus K02: B2K_02485Help
Entry
B2K_02485         CDS       T02041                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Brite
Enzymes [BR:pmw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B2K_02485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: AFH59602
UniProt: I0BB55
LinkDB All DBs
Position
complement(571946..573223)
Genome map
AA seq 425 aa AA seqDB search
MQYAYGALTPLRLLEETRFWKGQEREHTVVIRELAPALEPDYKRLLQEWEVVLTRAETSA
GRWIEALLRRPAPASPALRQEVRRFLEASAVQSQAFVRQLHLLMERSRTIRTQPPLRAIL
LHLIRESEYFLGVLQAAAGGPGAHEEGLFGGSFAPDDAQTGQEGQGGSDGHPLSAHDTGG
DPSEAQPPEEPYDSSGATATQEGVWTMGIRPVPAYAKPVPIGGHRLPPLPYPYDALEPHI
DKETMRLHHTKHHLSYVEGLNKAELALARAREIGDYALVKHWERETAFHGAGHYLHTLFW
QVMKPGGGGPPTGTIAADLKKSFGGFSPFRKQFSAAAEKVEGGGWALLVWSPRSHRLEIL
QAEKHQNLSQWDVIPLLVLDVWEHAYYVRYRNDRARYIEAWWNTIHWEHVNERLEAARGL
KWPPF
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgcttacggtgcgctcacgccgctcagactgctcgaggagacgcgcttctgg
aaaggacaggagcgtgagcatacggtcgtcatccgcgagctggcccccgcccttgaacct
gactacaaaaggctgctgcaggaatgggaggtcgtgctgacgcgggccgaaacctccgcc
gggcgctggatcgaggccttgctccgcaggccggctcccgcctccccggctctgcggcag
gaagtacggcgcttcctggaggcctcggctgtccaatcgcaggccttcgtccggcagctc
cacctgctcatggagagaagccgaacgattcggacccagcctcccctccgcgcgatactc
cttcatctcatccgggagtcggagtacttcctcggtgtgctccaggccgccgcaggaggg
cctggagcacacgaggagggactcttcgggggaagcttcgcaccggacgacgcgcagacc
ggacaagagggacagggaggatcggatgggcacccgctctctgcccacgacactgggggg
gatccgtctgaagcccagccgccggaagagccttatgacagctccggcgccacggcaacc
caggagggggtctggaccatgggcatccggcccgtcccggcttatgccaagccggttccc
atcggcggacatcggctccctccgcttccttatccgtacgatgctctcgaaccccatatc
gacaaagaaacgatgcgcctgcaccacaccaagcatcacttaagctatgtggagggcctc
aataaagcggagcttgccttggcccgcgcccgggagatcggcgattatgccctcgtgaag
cattgggagcgggaaaccgccttccacggagcggggcattacctccatacgctgttctgg
caggtgatgaagcccggagggggcggtccgcccaccggcaccattgcggcggacctcaag
aagtccttcggcggcttctcccctttccgcaagcagttcagcgcggccgccgagaaggtg
gaaggcggcggatgggcgcttctcgtctggagtccgcgcagccacaggctcgagatcctg
caggcggagaaacaccagaacttatcccagtgggacgtcatcccgctcctcgtactcgac
gtctgggagcatgcttactatgtccgctaccggaacgaccgtgcacgctacattgaagcc
tggtggaacactatacactgggagcacgtgaacgaacgcctggaagccgcacgcgggctc
aagtggcctcctttttga

DBGET integrated database retrieval system