KEGG   Paenibacillus mucilaginosus K02: B2K_08150Help
Entry
B2K_08150         CDS       T02041                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00020  Citrate cycle (TCA cycle)
pmw00480  Glutathione metabolism
pmw01100  Metabolic pathways
pmw01110  Biosynthesis of secondary metabolites
pmw01120  Microbial metabolism in diverse environments
pmw01130  Biosynthesis of antibiotics
pmw01200  Carbon metabolism
pmw01210  2-Oxocarboxylic acid metabolism
pmw01230  Biosynthesis of amino acids
Module
pmw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B2K_08150
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B2K_08150
Enzymes [BR:pmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     B2K_08150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AFH60688
UniProt: I0BE91
LinkDB All DBs
Position
1830159..1831454
Genome map
AA seq 431 aa AA seqDB search
MAQFEQYALPTEGERITITNGVLNVPNNPIIPFIEGDGTGPDIWAASKRVLDAAVEKAYN
GEKKIAWYEVFAGEKAFNKYNNWLPADTLTAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCSRPVRYFKGVPSPVKRPELVDMVIFRENTEDIYAGIEWAAGSEEVKKVLAFLQ
NEMGVKKIRFPETSGIGVKPVSSEGSKRLVRAAIEYAIKHNRKTVTLVHKGNIMKFTEGA
FKNWGYELAEEEFGDKTFTWAQYDRIKEESGADAANAAQKAAEAEGKIIVKDAIADIALQ
QVLTRPTDFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
AGLDVVNPGSVILSGVMMLEHLGWLEAAELIYKGMETAINNKTVTYDFARLMEGATEVKC
SAFADQIIANF
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggctcaattcgaacaatatgctctgccgactgagggcgagcgcatcacaattacgaac
ggcgtactgaacgtaccgaacaacccgatcattcctttcatcgaaggcgacggcacaggc
ccggacatctgggcggcttccaagcgtgtgctggatgcagcggtagagaaagcatataac
ggagagaagaaaatcgcttggtacgaagtgttcgccggcgagaaagccttcaacaagtac
aacaactggctgcctgctgatacgctgacagcgatccgtgaatacatcgtagcgatcaaa
ggtcctctgacgacgccaatcggcggcgggatccgctccctgaacgttgcgctccgtcaa
gagctggacctgtatgtctgctcccgtccggtccgctacttcaaaggcgtaccttcccct
gtaaagcgtcctgagctcgttgacatggtcatcttccgtgagaacaccgaagacatctat
gccggcatcgagtgggctgcaggctccgaagaagtcaagaaagtgctcgcgttcctccag
aacgaaatgggcgttaagaaaatccgcttcccagagacttccggtatcggcgtgaagccg
gtgtcctccgaaggatcgaagcgtctggttcgcgcggcgatcgaatatgcgatcaagcac
aaccgcaaaacggttactctcgtacacaaaggcaacatcatgaagttcaccgagggcgcg
ttcaagaactggggctacgagctggctgaagaggagttcggcgacaagaccttcacttgg
gctcaatacgaccgcatcaaagaagagtcgggtgcagatgcagcgaacgcagctcaaaaa
gcagcggaagctgaaggcaaaatcatcgtaaaagatgcgattgccgacatcgcgctgcag
caggttctgactcgtccgaccgacttcgacgtcatcgcgacgctgaacctgaacggcgac
tacctgtccgacgctctggctgctcaagtaggcggcatcggtatcgctcctggcgcgaac
atcaactatgtaacgggccacgcgatcttcgaagctacgcacggtacggctcctaagtac
gcaggtctggacgttgtgaacccaggttccgtcatcctctccggcgttatgatgctcgag
cacctgggctggctggaagcggctgagctgatctacaaaggcatggaaacggcgatcaac
aacaagaccgttacttatgactttgcccgtctgatggaaggcgcaactgaagtgaagtgc
tccgcgttcgctgatcagattattgccaatttttaa

DBGET integrated database retrieval system