KEGG   Paenibacillus mucilaginosus K02: B2K_11970Help
Entry
B2K_11970         CDS       T02041                                 

Definition
(GenBank) glycoside hydrolase family 2
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00052  Galactose metabolism
pmw00511  Other glycan degradation
pmw00600  Sphingolipid metabolism
pmw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    B2K_11970
  Lipid metabolism
   00600 Sphingolipid metabolism
    B2K_11970
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B2K_11970
Enzymes [BR:pmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     B2K_11970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_N Glyco_hydro_2_C Glyco_hydro_2 DUF4982 BetaGal_dom4_5 Invasin_D3
Motif
Other DBs
NCBI-ProteinID: AFH61428
UniProt: I0BGD1
LinkDB All DBs
Position
2756396..2758765
Genome map
AA seq 789 aa AA seqDB search
MTVVASKVSLQHRRVIPFDTDWLFTKGNYAGAKNPGFDDSRWRRLDVPHDWSIEEAFDPE
MEHGGSHAYLPRWTVAWYRKKFTLDEADQARRIVIEFDGVHNNSEVWINGHYLGSRPYGY
VPFQYDLTPYLHRDGENVLSVKVDNTVMPPDRWYSGSGIYRHVRLLSTDPVQVAQWGTYI
TTPQVSEASAKVVIRTNVRNGYAEAKACTVTTEIVDADGAVVGRGESKAVVPGGETAESA
QEIRVETPKRWSPEQPSLYHAYTTVAVDGQVTDDYITPLGIREIRFDSREGFFVNGVGTK
LKGVCIHHDLGCLGAAYNDRAMERRLAVLKEMGCNAVRFAHNPMTAELLDLCDRMGFLVV
DEAFDKWKSLYYAELFDEWWQADLEAMLLRDRNHPSIFLWSVGNEVEQQGQDSMLEMLDL
LVKHCHTVDPTRPVTCALEPHNWPMSLRSGTVEEKVAHTRKLAERVDILGLNYQEQWYEQ
YREAMPDTLILGTETFPFYRGKGSRVKGYEPVNPWFDVVKHDYVIGQFVWAGIDYLGESA
YPSKGWSSGLIDTCGFRKPVSYLQESLWSEEPMVQIAVFDDTLEQGHTPQWTKHWMSPPM
ASHWTFPHYEGRLLRLVTFTNCESVELVVGDESYEEKRLADHPDRLMVWHLPYAPGRVKA
VGRIGGRIVCTHELVTAGEARQLTLQADRTRLAADGIDLAHVEVIVTDEQGVPVPGAKHA
ISFSLEGEGTILGVDNGDLNSDEPYKANARSAYHGRCLVVVQAGKQAGTLRLTASAEGLE
AAAVTIVCE
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgttgcttcgaaagtaagcctgcagcatcggagagtcattcccttcgacacg
gactggctgttcacgaaaggaaattatgcgggagcgaaaaaccccggcttcgatgacagc
cggtggcggcggctcgatgtgccgcacgactggagcatcgaagaagcgttcgacccggag
atggagcacggcggcagccacgcttatctgccccggtggacggttgcctggtaccggaag
aaattcacgttggatgaggcggaccaagcacgaaggatcgtcatcgaattcgacggcgtc
cataacaacagcgaagtctggatcaacggacattacctcggcagcagaccttacggatac
gtcccttttcaatatgacctcaccccatatctccaccgggacggggagaatgtgctgtcg
gtgaaggtggacaatacggtcatgcctccggaccgctggtactccggctcggggatctac
cggcatgtccggctgctctccacggatcctgtgcaggtggcgcagtggggcacttacatc
accacaccgcaagtctcggaggcctcggcgaaagtcgtgatccgcacgaacgtccgcaac
ggctatgcggaggcaaaggcgtgcacggtcacgacggagatcgtggatgcggacggagcc
gtcgtcggcaggggcgaatcgaaggccgtcgttccgggcggggagaccgccgaatccgcg
caagagattcgggtggagacgccgaagcggtggagtccggagcagccgtccttgtaccat
gcctataccacggtggctgtcgacggtcaggtgaccgatgactatatcacgccgctgggg
atccgggagatccggttcgatagccgggagggcttcttcgtcaacggagtgggcacgaag
ctgaagggtgtctgcattcaccacgatctcggctgcctcggagcggcttacaacgaccgc
gccatggagcgccggctcgccgtgctgaaggagatgggctgcaacgcggtccgcttcgcc
cacaacccgatgacggcggaactgctcgatctgtgcgaccggatgggcttcctcgtggtc
gacgaggcgttcgacaagtggaaatcgctgtactacgcggagctgttcgatgaatggtgg
caggccgacctggaggccatgctgctgagggaccgcaaccacccgagcatcttcctgtgg
agcgtcgggaacgaagtggagcagcaggggcaggactccatgctcgagatgctggacctg
ctcgtgaagcactgccataccgtggacccaacccgcccggtgacctgcgcgctcgagccg
cataactggccgatgagcctgcgcagcggcacggtcgaggagaaggtggcgcatacccgg
aagctggcggagcgggtggacatcctcggcctgaactaccaggagcagtggtatgagcag
taccgcgaagcgatgccggataccctcatcctgggaaccgagaccttcccgttctaccgg
ggcaagggcagccgggtgaagggctacgaaccggtcaatccgtggttcgacgtcgtgaag
cacgactatgtcatcggccaattcgtctgggcgggcatcgactatctgggcgaatccgcc
tacccgtccaaaggctggtcctcgggcctgatcgatacgtgcggcttccgcaagccggtc
tcgtatctgcaggagagcttgtggtcggaagagccgatggtgcagatcgccgtgttcgac
gacacgctggagcaggggcatacaccgcagtggacgaagcactggatgtcgccgccgatg
gcctcccactggaccttcccgcactatgaaggcaggctgctgaggctggtgaccttcacg
aactgcgagagcgtggagctggtcgtgggcgacgagtcctacgaggagaagcggctcgcc
gaccatccggaccgcctgatggtctggcatctgccttatgcgccgggccgggtgaaggcg
gtcggccggatcgggggccggatcgtgtgcacccacgagctcgtaaccgcaggggaagcc
aggcagctgaccctgcaggccgatcgcacccggcttgccgcagacggcatcgaccttgcg
cacgtggaagtgatcgtgaccgatgagcaaggggtgcccgtaccgggtgcgaagcatgcg
atctccttctcgctcgagggggagggcacgatcctcggcgtggataacggggatctgaac
agtgacgagccgtataaggcgaacgccagatccgcgtaccacggccggtgcctggtggtg
gtgcaggcgggcaagcaggccgggacattacggctgacggcttcggccgaggggctggaa
gcggcggccgtgacgatcgtatgtgagtag

DBGET integrated database retrieval system