KEGG   Paenibacillus mucilaginosus K02: B2K_21150Help
Entry
B2K_21150         CDS       T02041                                 

Definition
(GenBank) LysR family transcriptional regulator
Organism
pmw  Paenibacillus mucilaginosus K02
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_30 HTH_5 MarR_2 HTH_24
Motif
Other DBs
NCBI-ProteinID: AFH63179
UniProt: I0BLD2
LinkDB All DBs
Position
4964300..4965190
Genome map
AA seq 296 aa AA seqDB search
MEWQQLEYFQTLARMQHVTRAAEALSLSQPALSRSIARLEEELGVPLFDRQGRTIVLNRY
GRLFLNRTDRILAEYKLAKQELSDLIDPDSGEVALGFLHTLSTGIIPDLIGGFRAGFPAV
RFQLIQNHSYSLLEHLHAGELDICLISQPSETRFPIRWTPLWSEEILVVLPLGHTLAGAG
SIQLQEIADEPFIFLKKGYALRELTDRLFEQAGIYPRITFEGEESATAAGLVAAGLGISL
LPRAGLDHSGVACVRLAGPPCERTVGFAELEGRFLPPAAERFKAYVLGYFGRLGSP
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggagtggcagcagctcgaatactttcagaccctcgcccggatgcagcatgtgacgcgg
gcggccgaggccttgtccctctcccagccggccctcagccgttcgatcgcccgcctggag
gaggagctgggcgtcccgctctttgaccgccagggccgcacgattgtcctgaaccgttac
ggacggctgttcctgaaccggaccgaccgtattctggccgaatacaagctcgccaagcag
gagctctccgatctcatcgatccggactccggtgaagtcgcgctcggcttcctgcatacg
ctgagcaccggtatcatccccgatctgatcggcggcttccgggccgggttcccggccgtc
cgctttcagctcatccagaatcacagctattccctgctcgagcatctgcatgccggagag
ctggatatttgcctgatttcccagccgtcggagacccgctttccgatccgctggactccg
ctgtggagcgaggagatcctcgttgtgctcccgctggggcatacgctggccggagccggg
agcatccaactgcaggagatcgcggatgaaccgttcattttcttgaagaaggggtatgcc
ctgagggaattgaccgacagattattcgagcaggcgggcatctatccgcggattacgttc
gagggcgaagaaagcgccacggcagccggactcgtggccgcggggcttggcatttcgctg
ctcccccgtgcaggattggaccacagcggagtggcctgcgtccggcttgccgggccgcca
tgcgaacggacggtcggcttcgccgagctggaggggcggtttctgccgcccgcggccgag
cgcttcaaagcgtatgtactgggctattttggcagactgggatcgccctga

DBGET integrated database retrieval system