KEGG   Paenibacillus mucilaginosus K02: B2K_21690Help
Entry
B2K_21690         CDS       T02041                                 

Definition
(GenBank) ribulose bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00630  Glyoxylate and dicarboxylate metabolism
pmw01100  Metabolic pathways
pmw01120  Microbial metabolism in diverse environments
pmw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    B2K_21690
Enzymes [BR:pmw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     B2K_21690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFH63276
UniProt: I0BLM9
LinkDB All DBs
Position
complement(5123710..5124990)
Genome map
AA seq 426 aa AA seqDB search
MGMLDERVTAVYLVETPYTLERAAEVIAGEQSTGTFTAVPGETASLKERHGAAIVSVEAL
EETDTPSLPGTKVPRGHDGKYRRGLIKVSYPLLNFGPSLPNLMSAVAGNLFELQELSGLR
LVDLELPEAFAAAYPGPKFGVEGTRRLTGVYGRPVIGTIVKPSVGLSMEQLGSLVREMAL
AGVDFIKDDELNANPPYAPLKDKVKAVMAEVERAADETGRRVMYAFNITGDIDELRRNHD
LVVEAGGNCVMVSINSIGVAGLSWLNRYSQVPIHAHRNGWGMMTRSPLLGMEFTVYQKLC
RLAGADHLHVNGLGSKFYESDESVVRSIRACRQPLFGGYGTMPVVSSGQWAGTAGITYEQ
AGTTDLMHLAGGGILAHPDGPAAGVESMKQGWEAAVKAVAAEEYAVTHGALRRAIERFGA
VEGRRA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgctggatgagcgggtgacagcggtgtacctggtcgaaaccccgtacaccctt
gaacgtgccgcagaagtgatcgcgggggagcagtccaccggcaccttcacggcggtgcct
ggggagactgcctctctcaaagaaaggcacggggccgccatcgtatcggtggaagcgctg
gaggagacggataccccgtctctgcccggcacgaaggtgccccgcgggcatgacgggaag
tacaggcggggcctcatcaaggtgagctatccgctgctgaatttcggaccttccctgccg
aacctgatgtcggccgtcgcaggcaatctcttcgagctgcaggagctctcgggcctgcgc
ctggtggacctggagctgccggaagcttttgcggccgcctatccggggccgaagttcggc
gtggaaggaacccggcggctgaccggggtctacggccggccggtgatcggaacgatcgtg
aagccgagcgtcgggctctcgatggagcagctcggcagccttgtccgggagatggcgctt
gcgggggtcgattttatcaaagacgacgagctgaacgcgaatcccccttacgctccgctg
aaggacaaagtgaaggcggtcatggccgaggtcgagcgggccgccgatgagacggggcgc
cgggtgatgtatgcgttcaacattaccggggacatcgatgagctccggagaaaccacgat
ctggtggtcgaggccggcgggaactgcgtgatggtcagcatcaacagcatcggagtggcc
ggtctgtcctggctgaaccgctacagccaggtgccgatccatgcgcaccgcaacggatgg
gggatgatgacccgctccccgctgctcgggatggagttcacggtataccagaagctgtgc
cggcttgcgggggccgaccatctgcatgtgaacggactcgggagcaagttctatgagagc
gacgaatccgtcgtgcgctcgatccgggcgtgcaggcagccgctgttcggcggttacggg
accatgccggtggtctcgtccggtcaatgggcgggtacagccgggatcacgtatgagcag
gcggggactaccgatctgatgcaccttgccggaggcggcatcctggcccacccggacggc
ccggccgccggcgtcgagagcatgaagcagggatgggaagccgccgtcaaggcggttgcg
gcagaggaatatgccgtgacgcatggagcgctccgcagggcgatcgagcggttcggagcg
gtggagggccgcagagcatga

DBGET integrated database retrieval system