KEGG   Paenibacillus mucilaginosus K02: B2K_30595Help
Entry
B2K_30595         CDS       T02041                                 

Definition
(GenBank) membrane protein
  KO
K06409  stage V sporulation protein B
Organism
pmw  Paenibacillus mucilaginosus K02
Brite
KEGG Orthology (KO) [BR:pmw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmw02000]
    B2K_30595
Transporters [BR:pmw02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   B2K_30595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt Polysacc_synt_C MurJ MatE
Motif
Other DBs
NCBI-ProteinID: AFH65003
UniProt: I0BRK6
LinkDB All DBs
Position
7249094..7250659
Genome map
AA seq 521 aa AA seqDB search
MTKQSFIKGTLILLAAGIINRILGFIPRMTLPRVIGSEGIGLYQMGWPFLVVILTLVTGG
IPVAVAKLIAAAEAEGSEARIRSIFRVSLALSTVLGLFFGAAIFYFAPWITSHVFTDSRV
YYTFLCMTPIVPIVAVSSVFRGYFQGRHNMIPTALSQVIETLIRIVTVLLFAYWMIPYGI
EYAAAGAMVGVTIGEIGAMLVLAIIYLRGRQSRPEKPRAEIGSRKPLNRLANLKNLLSLA
VPITGSKLVGSGSYLLESILTVHALAAAGLATGVATAQYGALQGMIIPVLLLPSALTFSL
AVSLVPSLSEAAARGDMKTIHMRLHQSLKLALVTGAPFAVLMYVLAEPICLYMYNQPGVG
AMLRMMAPAALFIYLQAPLQSALQALERPGSALVNTLVGSVVKLALIVMLASRPEFGILG
AVVAITVNIMLVTVLHWNSMVRLLQFRMEVSDFVKVGFSMAAAGVSSYSVMYSGWLPDGF
GKFASACFTGFVIYLLAATLLRLIDRDDLFRIFWLGKKFVK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaaacaatcgttcatcaaaggaacgctcatcctgctggccgcgggcatcatcaac
cgcatcctcggcttcatcccgcgcatgaccctgccccgggtcatcggctcggaggggatc
ggactgtaccagatgggctggccgttcctggtggtgatcttgacgctcgtcaccggcggc
attcccgtggcggtggccaagctgatcgcggcggccgaagcggagggcagcgaagcgcgc
atccggagcatcttccgcgtctctctggccctctccaccgtgctcggcctctttttcggc
gcagcgattttttattttgcaccctggatcacaagccacgtcttcacggattcccgggtg
tactatacgttcctgtgcatgacgccgatcgttccgatcgtcgccgtctcctcggtcttc
cgcggctatttccagggacggcacaatatgattccgaccgccctctcccaggtcatcgag
accctgatccgcatagtcaccgtgctgctcttcgcgtattggatgattccctacggcatt
gaatatgccgcagccggggcgatggtcggggtaaccatcggagagatcggcgccatgctc
gtgctggccatcatctacctccgcggccggcagagccggccggagaagccccgcgccgag
atcggcagccggaagccgctgaaccggctggccaacctgaagaacctgctgtccctcgcc
gttccgattacaggcagcaagctcgtaggctcaggctcgtatctgcttgagtcgatcctg
accgtgcatgcccttgcggcggcaggccttgccaccggtgtggccaccgcccagtacggt
gccctgcaggggatgatcatccccgtgctgctcctgccgagcgcgctgaccttctccctc
gccgtctccctggttccgtccttatctgaagcggcggcgcgcggtgacatgaaaacgatc
catatgcggctgcaccagtccctgaaactcgcgctggtcaccggtgcgccgttcgccgtc
ttgatgtatgtgctggccgagccgatctgcctctatatgtacaaccagccgggtgtgggc
gccatgctgcgcatgatggctccggcggctttgttcatttacttgcaggctccgctccag
tccgctctgcaggcgctcgaaagacccggtagcgcactggtcaatacactcgtcgggtcg
gtggtcaagcttgcgctgattgtcatgctcgcctcccggcctgaattcggcatcctggga
gcggtggtggccattacggtgaacatcatgctggtcaccgtcctgcactggaacagcatg
gtccgcctgctgcagttccggatggaggtctccgacttcgtcaaggtgggcttcagcatg
gcggcggcaggggtgtccagctactccgtcatgtattccggatggctgccggacggcttc
ggcaaattcgcctccgcctgttttacgggattcgtcatctacctcctggccgccaccctg
ctccggctcatcgaccgggacgatctcttccggatcttctggctcgggaaaaagttcgtt
aaataa

DBGET integrated database retrieval system