KEGG   Paenibacillus mucilaginosus K02: B2K_37125Help
Entry
B2K_37125         CDS       T02041                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
pmw00564  Glycerophospholipid metabolism
pmw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B2K_37125
Enzymes [BR:pmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     B2K_37125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored GMC_oxred_N Pyr_redox_2 GIDA 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AFH66258
UniProt: I0BV61
LinkDB All DBs
Position
complement(8691104..8692792)
Genome map
AA seq 562 aa AA seqDB search
MEHIFSSRSRVGQLQEISREPLDILVIGGGITGSGIALDAVSRGLRTGLVEMQDFAAGTS
SRSTKLVHGGLRYLKQLEVKMVAEVGKERAIVYENGPHVTTPEWMLLPMHKGGTFGKFTT
SIALRMYDYLAGVKRSERRKMLTALETLRREPLLKSAGLKGGGYYVEYRTDDARLTIEVL
KEAVSRGAHAVNYAKVERLLYDNGRVVGAHVVDGETGTGYDVYAKKVVNAAGPWVDTLRE
MDGSRKGKTLQLTKGVHLVIDQKRFPLRQAVYFDTPDGRMVFAIPRDGKTYVGTTDTVYK
EEIAHPRMTTADRKYVIDAVNYMFPDVGLTVRDVESSWAGVRPLIHEEGKDPSEISRKDE
IWQSESGLITIAGGKLTGYRKMAELVVDLVAQLLSAEGSGAYGASITKHMPISGGSVGGS
AGFPQFIQSKTAEGERLGLPRETAASWARMYGSNADRLFGMAQTCRAEAEVSGLPLEVFV
PLLYAIEEEMAARPVDFFIRRTGALFFDIAWVRKWKAPAVEVMARRLGWTSEQKERYAAE
LEKHLHDAVVPSDEEQQRRFAI
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
gtggaacatatcttttctagcagaagcagagtagggcaattacaggagatcagccgggaa
ccgcttgatattcttgtcatcggagggggcattaccgggtcgggcattgcgctggatgcc
gtgtcccgcggattgagaacgggactggtggagatgcaggactttgcggccggcacatcg
tcacggtcgacgaagctggtgcacgggggactccggtatctcaagcagcttgaggtgaaa
atggtggccgaggtcggcaaggaacgggcgatcgtgtacgagaacggaccgcacgtgacg
acaccggagtggatgctgctgccgatgcataagggaggcaccttcggcaaattcacgacg
tctatcgcgctgcgcatgtacgactacctggcaggggtaaagcgcagcgaaagaaggaaa
atgcttacggcgcttgagaccctgcgccgggagccgctgctgaagagcgcggggctgaag
ggcggcggctattacgtggaataccgtacggatgacgcccggctgacgattgaagtgctg
aaggaagcggtcagccgcggagcccatgcggtgaactatgccaaggtcgagcgtctgctg
tacgataacggccgggtcgtcggggcgcatgtagtcgatggggaaaccggaacgggctac
gatgtgtacgccaaaaaagtcgttaacgccgcaggcccctgggtggatacgctgcgggag
atggacggctcgaggaagggcaaaaccctgcagctgaccaagggggtccacctggtcatt
gaccagaagcggttcccgctccggcaggcagtctacttcgatacgccggacggccggatg
gtgttcgccatcccgcgggacgggaagacctatgtgggtacaaccgatacggtgtataag
gaagaaatcgcccatccgcggatgaccacggcggaccgcaaatacgtgatcgatgcggtc
aattacatgttccctgacgtgggccttacggttcgtgacgtggaatcgagctgggcgggg
gttcgtccgctgattcatgaggaaggcaaggatccgtccgagatctcgcgcaaggacgag
atctggcagtccgaatccggcctcattacgattgcgggcggcaagctgacaggctaccgc
aagatggcggagctcgtcgtcgatctggtggcccagctgctgtccgcggaaggttcgggt
gcgtatggagccagtattaccaagcatatgccgatctccggcggctccgtcggcggctcc
gcgggattcccgcagttcattcagtcgaagacggcggaaggcgaacggctcggcctgccc
cgggagacggcggcctcctgggcgcgcatgtacggctcgaatgccgaccgtctcttcggg
atggcgcagacctgccgcgcggaggcggaggtaagcggcctgccgctggaagtattcgta
cctctgctctatgcgatcgaagaggagatggccgcccggccggtggacttcttcatccgc
cgtaccggtgccctgtttttcgatatcgcctgggtgaggaagtggaaggcgccggccgtg
gaggtgatggcccgccggctgggctggacgtccgagcagaaggagcggtacgccgccgag
ctcgagaagcaccttcacgatgcggtggttccgtcggatgaggagcagcagcgccggttc
gcgatctga

DBGET integrated database retrieval system