KEGG   Persephonella marina: PERMA_1901Help
Entry
PERMA_1901        CDS       T00870                                 

Definition
(GenBank) DNA ligase (Polydeoxyribonucleotide synthase [ATP])(Lig(Tk))
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pmx  Persephonella marina
Pathway
pmx03030  DNA replication
pmx03410  Base excision repair
pmx03420  Nucleotide excision repair
pmx03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pmx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PERMA_1901
   03410 Base excision repair
    PERMA_1901
   03420 Nucleotide excision repair
    PERMA_1901
   03430 Mismatch repair
    PERMA_1901
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pmx03032]
    PERMA_1901
   03400 DNA repair and recombination proteins [BR:pmx03400]
    PERMA_1901
Enzymes [BR:pmx01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PERMA_1901
    6.5.1.6  DNA ligase (ATP or NAD+)
     PERMA_1901
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PERMA_1901
DNA replication proteins [BR:pmx03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PERMA_1901
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PERMA_1901
DNA repair and recombination proteins [BR:pmx03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PERMA_1901
   NER (nucleotide excision repair)
    Other NER factors
     PERMA_1901
   MMR (mismatch exicision repair)
    Other MMR factors
     PERMA_1901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ACO03229
UniProt: C0QSL7
LinkDB All DBs
Position
complement(1814980..1816728)
Genome map
AA seq 582 aa AA seqDB search
MEYTKLAQLYQILEETTSRIKMTQALVDLFKETPPELIDKVVYLSIGRIAPEYTGLDYNF
SEKSAIKALSTVLNISEHDIQHQVLQTGDLGDAGKKLYEEKGVKPEGILTVEEVYRTLRE
IAQTTGYGSTKKKLQLFTELLKKASPLEVKYLLRTITERLRLGIGDNTIMDALSIAFTGK
KENREIIERAYNISSDLGYVARILAEKGLDAVKNIKIEIGRPIRPMLAERMAIPSYILKK
LGGKAGAEYKYDGERIQVHRKGDTFYLFSRRLENITDQFPDLIEFLKESIPEECIIELEA
VVIDPSSGAIRPFQDLMNRRVKYVTRFHIMMYPIAGFIFDIMYLNGEDLTLKPYPERRKI
LEENIKITERINLSERKIVDNVEDLESFFHQAIEDGCEGLVCKSLQKDSIYQAGKRGFLW
IKYKRDYKSHLADTLDLVVVGAFYGKGARTGYFGSLLMACYDPETDQFKTVCKVGTGFKE
DDFKKLDDLLKEHTLDHKHPRVNSILSADIWYEPFLVLEITGAELTLSPVHTCGWDRIKI
NRGLGLRFPRFTGRYRFDKRPEDATTEEEIINMYKNQIQIKS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggaatacacaaagttagctcagctttaccagattcttgaagagacaacaagcaggata
aagatgacacaggctcttgttgatctttttaaagaaacaccaccagaactgatagataaa
gttgtatatctatcaatcggaagaatagcaccggaatacacaggtcttgactacaacttc
agtgaaaagtccgcgattaaagctctatcaactgtactgaacatatctgaacatgatatc
cagcatcaggttttacagacaggtgatcttggcgacgctggaaagaagctttacgaggaa
aaaggtgtaaagcctgaagggatcttaactgttgaggaagtttacagaacgctcagggag
atagcccagactacaggatacggatcaacaaaaaagaagctacagcttttcactgagctt
ctaaagaaggcttccccactggaggttaagtaccttctcagaaccataactgaaagatta
agacttggtataggcgataacacaataatggatgccctctcaatagccttcacaggaaaa
aaggagaacagagagataatagagagagcttacaacatatcctctgatcttggttatgtt
gcaaggattcttgctgaaaaaggtttagatgctgtcaaaaatataaagatagagatagga
agacctataagacctatgcttgctgaaaggatggccataccatcatacatacttaaaaaa
cttggtggaaaagctggagcagaatacaagtatgatggagagagaatacaggttcacaga
aagggagacacattttacctgttttcaagaagacttgagaacataacagaccagtttcca
gaccttattgagtttttaaaggagagtatcccggaagaatgtataattgagcttgaggct
gttgttatagatccatcatcaggggctataagaccatttcaggatcttatgaacagaagg
gtcaagtatgtaacaagatttcatataatgatgtacccgatagcaggttttatatttgat
atcatgtatcttaatggagaggatctgacattaaagccttatcctgagagaagaaagata
cttgaggagaacataaagataacagagaggataaacctttctgagagaaagatagttgat
aatgttgaagatcttgaatcattcttccatcaggctatagaggatggatgtgaaggttta
gtatgtaaatctctccagaaggactctatctatcaggctggaaagaggggattcctctgg
attaaatataaaagggattacaaatcacaccttgcagacactcttgatcttgttgttgtt
ggcgctttttatgggaaaggtgcaagaaccggatattttggctcacttcttatggcgtgt
tacgatcctgaaacagatcagtttaaaaccgtctgtaaagttggaacaggattcaaagag
gatgattttaaaaaacttgacgatctgctaaaggagcataccctggaccataaacatccc
cgtgttaactcaatactatccgctgatatatggtatgagcctttcctggtccttgagatc
acaggagcagagctcacattaagtccggttcacacatgtggatgggacaggataaagata
aacagaggacttggacttagatttccaaggtttacagggagatacaggtttgataaaagg
cctgaagatgcaacaacggaagaagagataataaatatgtataaaaaccagatacagata
aaaagttag

DBGET integrated database retrieval system