KEGG   Pseudomonas mendocina ymp: Pmen_1324Help
Entry
Pmen_1324         CDS       T00510                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pmy  Pseudomonas mendocina ymp
Brite
KEGG Orthology (KO) [BR:pmy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pmen_1324
Enzymes [BR:pmy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Pmen_1324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored Glutaredoxin AlaDh_PNT_C NAD_binding_8 Thi4 DAO FAD_binding_3 K_oxygenase FMO-like Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: ABP84089
UniProt: A4XRX3
LinkDB All DBs
Position
1484061..1485617
Genome map
AA seq 518 aa AA seqDB search
MLDANLKAQLKAYLEKVTLPFEIVASLDDSAKSQELLGLLQDIVGLTDKITLKTDGRDAR
RPSFSLVRPGADIGLTFAGIPMGHEFTSLVLALLQVGGHPSKLDADTIAQIKSIEGKFEF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRNVSIDGALFQEEVERRQIMAVPSIYLNGEVF
ASGRMDVKEILAKIDTGAANRDAEKMSAKEAFDVLVVGGGPAGAAAAIYAARKGIRTAIA
AERFGGQVLDTMAIENFISVKETEGPKLVRALEEHVKEYEVDVMNLQRASALVPASSEGG
LHEVKFENGASLKAKTVILSTGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLLEFADTLRADAVLQKKLFSLPNVTVIKSAQTTEVTGDG
QKVNGLVYKDRTTEELHRVELEGIFVQIGLLPNSDWLKGTVELSRFGEIVVDAKGATNIP
GVFAAGDVTTVPYKQIVIAMGEGSKASLSAFDHLIRHS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaggcctacctggagaaggtcaccctgccg
ttcgagatcgtcgcgtccctcgatgacagcgcgaaatctcaggagctgctgggcctgctg
caagacatcgtcggtctgaccgacaagatcaccctgaagaccgacggccgcgatgcccgc
cgcccgtcgttctcgctggtgcgccccggcgcggatatcggcctgaccttcgccggtatt
cccatgggccacgagttcacctcgctggtgctggcgctgctgcaggttggtggccatccg
tccaagctggatgccgacaccatcgcgcagatcaagagcatcgagggcaagttcgagttc
gagacctacttctcgctctcctgccagaactgcccggacgtggttcaggcgctgaacctg
atggccgtgctcaaccccaatatccgcaacgtctccatcgacggtgcgctgttccaggaa
gaagtcgagcgtcgccagatcatggccgtgccgagcatctacctgaacggtgaggtgttc
gcttccggccgcatggacgtgaaggaaattctcgccaagatcgacaccggcgccgccaac
cgcgatgccgagaagatgagcgccaaggaagccttcgacgtgctggtggtcggcggtggc
ccggccggtgctgcggcggccatctacgccgcacgtaaaggcatccgcaccgcgattgcc
gccgagcgcttcggtggtcaggtgctggacaccatggccatcgagaacttcatctcggtc
aaggagaccgaaggcccgaaactggtgcgcgcgctggaagaacacgtcaaggaatacgaa
gtcgacgtgatgaacctgcagcgtgcctcggccctggtgccggccagcagtgaaggcggc
ctgcacgaagtgaagttcgagaacggcgcctcgctcaaggccaagaccgtgatcctctct
accggcgcgcgctggcgtgagatgggcgtgcccggcgagcaggagtacaaggccaagggc
gtgtgcttctgcccgcactgcgatggcccgctgttcaagggcaagcgcgtggcggtgatc
ggtggcggcaactccggcgtcgaggcggccatcgacctggccggcatcgtcgcccacgtc
accctgctggaattcgccgataccctgcgcgccgacgccgtgctgcagaagaagctgttc
agcctgcccaacgtgaccgtgatcaagagcgcgcagaccaccgaggtcactggcgacggt
cagaaggtcaacggcctggtgtacaaggaccgcaccaccgaggagctgcatcgcgtcgag
ctggaaggcatcttcgtgcagatcggtctgctgcccaacagcgactggctcaagggcacc
gtcgagctcagccgcttcggcgagatcgtcgtcgatgccaagggcgcgaccaacatcccc
ggcgtgttcgctgccggtgacgtgaccaccgtgccgtacaagcagatcgtcatcgccatg
ggcgagggctcgaaggcatcgctgagcgccttcgaccacctgatccgccacagctga

DBGET integrated database retrieval system