KEGG   Pseudomonas mendocina ymp: Pmen_1347Help
Entry
Pmen_1347         CDS       T00510                                 

Definition
(GenBank) superoxide dismutase, copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pmy  Pseudomonas mendocina ymp
Brite
Enzymes [BR:pmy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Pmen_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ABP84112
UniProt: A4XRZ6
LinkDB All DBs
Position
1507646..1508197
Genome map
AA seq 183 aa AA seqDB search
MKPLIPLAFALLGATSLQASETVTVTLEQATENGPGAPVGSVTISQSPYGLVFTPELQGL
EPGVHGFHVHTEANCNAAEVDGKLTPAGAAGGHWDPQNAGRHGFPWEDDAHLGDLPALLV
TEDGTASQPVLAPRLKNLQDLHNRSLMIHAGGDNHADHPQPLGGGGARVACGLIKVPTST
TPI
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccctgattcccctggcattcgcgctgcttggcgccaccagcctgcaggccagc
gagacggtcaccgtgacgctcgagcaggccaccgagaacggtcctggcgcgcctgtcggc
agcgtgaccatcagccagtcgccctacgggctggtctttacccccgaattgcagggcctg
gagcctggcgtccacggctttcacgtgcacacggaggccaactgcaacgccgccgaggtg
gatggcaagctgacgccggccggcgcggccggcggccactgggacccgcagaacgccggg
cgccatggcttcccctgggaagacgacgcccacctgggcgacctgcctgcgctgctggtg
accgaggatggcaccgccagccagccggtgctggcgccgcgactcaagaacctgcaagac
ctgcacaaccgttcgctgatgatccacgccggcggtgacaatcacgccgatcacccgcag
ccgctgggtggtggcggggcgcgcgtggcctgcgggctgatcaaggtgccgaccagcacc
acgccgatctga

DBGET integrated database retrieval system