KEGG   Pseudomonas mendocina ymp: Pmen_1580Help
Entry
Pmen_1580         CDS       T00510                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pmy  Pseudomonas mendocina ymp
Pathway
pmy00071  Fatty acid degradation
pmy00280  Valine, leucine and isoleucine degradation
pmy00281  Geraniol degradation
pmy00310  Lysine degradation
pmy00362  Benzoate degradation
pmy00380  Tryptophan metabolism
pmy00410  beta-Alanine metabolism
pmy00640  Propanoate metabolism
pmy00650  Butanoate metabolism
pmy00903  Limonene and pinene degradation
pmy00930  Caprolactam degradation
pmy01100  Metabolic pathways
pmy01110  Biosynthesis of secondary metabolites
pmy01120  Microbial metabolism in diverse environments
pmy01130  Biosynthesis of antibiotics
pmy01200  Carbon metabolism
pmy01212  Fatty acid metabolism
Module
pmy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Pmen_1580
   00650 Butanoate metabolism
    Pmen_1580
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pmen_1580
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pmen_1580
   00310 Lysine degradation
    Pmen_1580
   00380 Tryptophan metabolism
    Pmen_1580
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pmen_1580
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pmen_1580
   00281 Geraniol degradation
    Pmen_1580
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pmen_1580
   00930 Caprolactam degradation
    Pmen_1580
Enzymes [BR:pmy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Pmen_1580
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pmen_1580
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Pmen_1580
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Pmen_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABP84344
UniProt: A4XSM8
LinkDB All DBs
Position
1742502..1744649
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNELRASVDAIKADGSIKGVIVTS
GKDVFIVGADITEFVDNFKLPDEELVAGNLEANKIFSDFEDLAVPTVVAINGIALGGGFE
MCLAGDYRVMSETAKIGLPEVKLGIYPGFGGTVRLPRVIGTDNAVEWIASGKENKAADAL
KVGAVDAVVAPAKLKEAALDLVKRAISGELDYKAKRQPKLEKLKLNAIEQMMCFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSVAESLIGLFLNDQEL
KKKAKHHDEIARDVKLAAVLGAGIMGGGIAYQSASKGTPILMKDIREEGIQMGLTEASKL
LGKRVEKGRMTPAKMAEALNAIRPTMSYGDFGNVDIVVEAVVENPKVKQIVLAEVEDVVR
EDAILASNTSTISISLLAQALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFSKLLGFGVDFVRIDKVMEKFGWPMGPAYL
SDVVGIDTGHHGRDVMAEGFPDRMAVEGKTAVDVMYEANRLGQKNGKGFYAYETDKRGKP
KKVSDPEAYELLKSIVVEEREVTDEDIINFMMIPLCLETVRCLEDGIVDTAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVALADKYADLGALYHPTAKLREMAAKGQKFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgagagcggcatcgtcgaattg
aatttcgacctcaagggtgagtccgtcaacaaattcaaccgtcttaccctcaacgagctg
cgcgcctccgtcgacgcgatcaaggccgacggttcgatcaagggcgtgattgtcaccagt
ggcaaggacgtgttcatcgtcggtgccgatatcaccgaattcgtcgacaacttcaaactg
cccgacgaagagctggtggctggcaacctggaagccaacaagatcttcagtgatttcgaa
gacctcgccgtgcccaccgtcgtcgccatcaacggcatcgccctgggtggcggtttcgag
atgtgcctggccggtgactaccgcgtaatgagcgagaccgccaagatcggtctgccggaa
gtcaaactgggcatctacccgggcttcggcggcaccgtgcgcctgcctcgcgtgatcggc
accgacaacgctgtcgagtggatcgcctccggtaaggaaaacaaggctgccgacgccctc
aaggtaggcgccgtcgatgccgtcgtcgcccccgccaagctcaaggaagccgcgctggat
ctggtcaagcgcgccatctccggcgagctggactacaaggccaagcgtcagcccaagctg
gaaaagctcaagctcaacgccatcgagcagatgatgtgcttcgagaccgccaagggcttc
gttgctggccaggccggcccgaactacccggctccggtcgaggcgatcaagaccattcag
aaagccgccaacttcggccgcgacaaggcgctggaagtcgaggccgccggcttcgtcaaa
ctggccaagacctcggtcgccgagagcctgatcggcctgttcctcaacgatcaggaactg
aagaagaaggccaaacaccacgacgaaatcgcccgcgacgtgaaactggctgccgtactc
ggcgccggcatcatgggcggcggcatcgcctaccagtcggcctccaagggcaccccgatc
ctgatgaaggatatccgcgaagagggtatccagatgggcctgaccgaggcctccaagctg
ctcggcaagcgcgtcgagaaaggtcgcatgaccccggcgaagatggctgaagccctcaat
gccatccgtccgaccatgtcctacggtgatttcggcaacgtcgacatcgtcgtcgaagcc
gtggttgagaaccccaaggtcaagcagatcgtgctggccgaagtggaagacgtggtgcgc
gaagacgccatcctggcctccaacacctcgaccatctccatctccctgctggcccaggcg
ctcaagcgtccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtcattcgtggcgagaagtccagcgaagtggccgtggccaccaccgttgcc
tacgccaagaagatgggcaagaacccgatcgtggtcaacgactgccccggcttcctggtc
aaccgcgtgctgttcccgtacttcggtggcttctccaagctgctgggcttcggtgtcgac
ttcgtgcgcatcgacaaggtcatggagaagttcggctggcccatgggcccggcctacctc
tccgacgtggtcggcatcgacaccggccaccacggccgtgacgtgatggccgaaggcttc
ccggaccgcatggcggtggaaggcaagaccgctgtcgacgtgatgtacgaagccaatcgc
ctgggccagaagaacggcaagggcttctacgcctacgagaccgacaagcgcggcaagccg
aagaaggtctccgaccctgaagcttacgagctgctcaagtccatcgtggtcgaagagcgt
gaagtcaccgacgaggacatcatcaacttcatgatgatcccgctgtgcctggaaaccgtt
cgttgcctggaagacggcatcgtcgataccgcagccgaggccgatatgggcctgatctac
ggcatcggcttccctcccttccgtggcggtgcgctgcgctacatcgattccatcggtgtc
gccgagttcgtcgccctggccgacaagtacgccgacctgggcgcgctgtaccacccgacc
gccaagcttcgcgaaatggccgccaagggccagaagttcttcggttaa

DBGET integrated database retrieval system